Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yafN-yafO (relBE)/YafO-YafN
Location 3965120..3965814 Replicon chromosome
Accession NZ_CP103718
Organism Escherichia coli strain 1579

Toxin (Protein)


Gene name yafO Uniprot ID A0A0D8WHS4
Locus tag M5S87_RS19145 Protein ID WP_001521903.1
Coordinates 3965120..3965518 (-) Length 133 a.a.

Antitoxin (Protein)


Gene name yafN Uniprot ID S1QAE3
Locus tag M5S87_RS19150 Protein ID WP_000554758.1
Coordinates 3965521..3965814 (-) Length 98 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
- (3960950) 3960950..3961030 - 81 NuclAT_11 - -
- (3960950) 3960950..3961030 - 81 NuclAT_11 - -
- (3960950) 3960950..3961030 - 81 NuclAT_11 - -
- (3960950) 3960950..3961030 - 81 NuclAT_11 - -
M5S87_RS19115 (3960290) 3960290..3961534 - 1245 WP_000189541.1 esterase FrsA -
M5S87_RS19120 (3961626) 3961626..3962084 - 459 WP_001291990.1 xanthine phosphoribosyltransferase -
M5S87_RS19125 (3962345) 3962345..3963802 + 1458 WP_001293009.1 cytosol nonspecific dipeptidase -
M5S87_RS19130 (3963859) 3963859..3964211 - 353 Protein_3745 peptide chain release factor H -
M5S87_RS19135 (3964207) 3964207..3964413 - 207 Protein_3746 RtcB family protein -
M5S87_RS19140 (3964658) 3964658..3965110 - 453 WP_023144376.1 GNAT family N-acetyltransferase -
M5S87_RS19145 (3965120) 3965120..3965518 - 399 WP_001521903.1 type II toxin-antitoxin system mRNA interferase toxin YafO Toxin
M5S87_RS19150 (3965521) 3965521..3965814 - 294 WP_000554758.1 type I toxin-antitoxin system antitoxin YafN Antitoxin
M5S87_RS19155 (3965866) 3965866..3966921 - 1056 WP_001226177.1 DNA polymerase IV -
M5S87_RS19160 (3966992) 3966992..3967777 - 786 WP_000207556.1 putative lateral flagellar export/assembly protein LafU -
M5S87_RS19165 (3967749) 3967749..3969461 + 1713 Protein_3752 flagellar biosynthesis protein FlhA -
M5S87_RS19170 (3969540) 3969540..3969893 + 354 WP_024166466.1 type II toxin-antitoxin system HicB family antitoxin -
M5S87_RS19175 (3969950) 3969950..3970699 - 750 WP_016233951.1 C40 family peptidase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 3955057..3965814 10757


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase toxin YafO

(27-130)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 15471.88 Da        Isoelectric Point: 8.0949

>T256340 WP_001521903.1 NZ_CP103718:c3965518-3965120 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGILPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF

Download         Length: 399 bp

Antitoxin


Download         Length: 98 a.a.        Molecular weight: 11233.76 Da        Isoelectric Point: 5.2170

>AT256340 WP_000554758.1 NZ_CP103718:c3965814-3965521 [Escherichia coli]
MHRILAEKSVNITELRKNPAKYFIDQPVAVLSNNRPAGYLLSASAFEALMDMLAEQEEKKPIKARFRPSAARLEEITRRA
EQYLNDMTDDDFNDFKE

Download         Length: 294 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0D8WHS4

Antitoxin

Source ID Structure
AlphaFold DB S1QAE3

References