Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ralRA/- |
Location | 2359940..2360311 | Replicon | chromosome |
Accession | NZ_CP103718 | ||
Organism | Escherichia coli strain 1579 |
Toxin (Protein)
Gene name | ralR | Uniprot ID | A0A0D6ZRD3 |
Locus tag | M5S87_RS11375 | Protein ID | WP_001443846.1 |
Coordinates | 2360162..2360311 (-) | Length | 50 a.a. |
Antitoxin (RNA)
Gene name | ralA | ||
Locus tag | - | ||
Coordinates | 2359940..2360118 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5S87_RS11350 (2355895) | 2355895..2357268 | + | 1374 | WP_000123748.1 | ATP-dependent RNA helicase DbpA | - |
M5S87_RS11355 (2357397) | 2357397..2358332 | - | 936 | WP_001523172.1 | tRNA 2-thiocytidine(32) synthetase TtcA | - |
M5S87_RS11360 (2358384) | 2358384..2359619 | - | 1236 | WP_000040839.1 | site-specific integrase | - |
M5S87_RS11365 (2359621) | 2359621..2359836 | - | 216 | WP_000079604.1 | excisionase XisR | - |
- (2359940) | 2359940..2360118 | + | 179 | NuclAT_0 | - | Antitoxin |
- (2359940) | 2359940..2360118 | + | 179 | NuclAT_0 | - | Antitoxin |
- (2359940) | 2359940..2360118 | + | 179 | NuclAT_0 | - | Antitoxin |
- (2359940) | 2359940..2360118 | + | 179 | NuclAT_0 | - | Antitoxin |
M5S87_RS11370 (2359936) | 2359936..2360124 | - | 189 | WP_001302840.1 | DUF1187 family protein | - |
M5S87_RS11375 (2360162) | 2360162..2360311 | - | 150 | WP_001443846.1 | type I toxin-antitoxin system endodeoxyribonuclease toxin RalR | Toxin |
M5S87_RS11380 (2360367) | 2360367..2361176 | - | 810 | WP_000166313.1 | recombination protein RecT | - |
M5S87_RS11385 (2361169) | 2361169..2363769 | - | 2601 | WP_000105140.1 | exodeoxyribonuclease VIII | - |
M5S87_RS11390 (2363871) | 2363871..2364146 | - | 276 | WP_001344816.1 | hypothetical protein | - |
M5S87_RS11395 (2364221) | 2364221..2364391 | - | 171 | WP_001352098.1 | YdaE family protein | - |
M5S87_RS11400 (2364391) | 2364391..2364612 | - | 222 | WP_000560223.1 | killing protein KilR | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 2358384..2409523 | 51139 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5383.12 Da Isoelectric Point: 8.3398
>T256326 WP_001443846.1 NZ_CP103718:c2360311-2360162 [Escherichia coli]
MRYDNVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALER
MRYDNVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALER
Download Length: 150 bp
Antitoxin
Download Length: 179 bp
>AT256326 NZ_CP103718:2359940-2360118 [Escherichia coli]
GAGGACTGAAGTTTCTCGCAATTAAAATTTATCAGTTTTACTTTCTGCTCTCTGGAAACGCCTGCTTCTTTTTTACCTGA
GAGCATTTTTTCGCATTCTGATTTCGTTAGTTTAGATTTTGAATATCTTGTCCAGTTAGTAGGAGTGCCACCTTCCTTTT
CAATAGTGGCGGTAATTTT
GAGGACTGAAGTTTCTCGCAATTAAAATTTATCAGTTTTACTTTCTGCTCTCTGGAAACGCCTGCTTCTTTTTTACCTGA
GAGCATTTTTTCGCATTCTGATTTCGTTAGTTTAGATTTTGAATATCTTGTCCAGTTAGTAGGAGTGCCACCTTCCTTTT
CAATAGTGGCGGTAATTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|