Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 2209608..2209829 Replicon chromosome
Accession NZ_CP103718
Organism Escherichia coli strain 1579

Toxin (Protein)


Gene name ldrD Uniprot ID A0A229AEQ8
Locus tag M5S87_RS10600 Protein ID WP_000176713.1
Coordinates 2209608..2209715 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 2209763..2209829 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5S87_RS10570 (2205113) 2205113..2205946 + 834 WP_000456570.1 peptide chain release factor N(5)-glutamine methyltransferase -
M5S87_RS10575 (2205943) 2205943..2206335 + 393 WP_000200377.1 invasion regulator SirB2 -
M5S87_RS10580 (2206339) 2206339..2207148 + 810 WP_001257044.1 invasion regulator SirB1 -
M5S87_RS10585 (2207184) 2207184..2208038 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
M5S87_RS10590 (2208233) 2208233..2208691 + 459 WP_000526135.1 IS200/IS605-like element IS200C family transposase -
M5S87_RS10595 (2208944) 2208944..2209402 + 459 WP_000526135.1 IS200/IS605-like element IS200C family transposase -
M5S87_RS10600 (2209608) 2209608..2209715 - 108 WP_000176713.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (2209765) 2209765..2209828 + 64 NuclAT_46 - -
- (2209765) 2209765..2209828 + 64 NuclAT_46 - -
- (2209765) 2209765..2209828 + 64 NuclAT_46 - -
- (2209765) 2209765..2209828 + 64 NuclAT_46 - -
- (2209765) 2209765..2209828 + 64 NuclAT_48 - -
- (2209765) 2209765..2209828 + 64 NuclAT_48 - -
- (2209765) 2209765..2209828 + 64 NuclAT_48 - -
- (2209765) 2209765..2209828 + 64 NuclAT_48 - -
- (2209763) 2209763..2209829 + 67 NuclAT_21 - Antitoxin
- (2209763) 2209763..2209829 + 67 NuclAT_21 - Antitoxin
- (2209763) 2209763..2209829 + 67 NuclAT_21 - Antitoxin
- (2209763) 2209763..2209829 + 67 NuclAT_21 - Antitoxin
- (2209763) 2209763..2209829 + 67 NuclAT_26 - Antitoxin
- (2209763) 2209763..2209829 + 67 NuclAT_26 - Antitoxin
- (2209763) 2209763..2209829 + 67 NuclAT_26 - Antitoxin
- (2209763) 2209763..2209829 + 67 NuclAT_26 - Antitoxin
- (2209763) 2209763..2209829 + 67 NuclAT_31 - Antitoxin
- (2209763) 2209763..2209829 + 67 NuclAT_31 - Antitoxin
- (2209763) 2209763..2209829 + 67 NuclAT_31 - Antitoxin
- (2209763) 2209763..2209829 + 67 NuclAT_31 - Antitoxin
- (2209763) 2209763..2209829 + 67 NuclAT_36 - Antitoxin
- (2209763) 2209763..2209829 + 67 NuclAT_36 - Antitoxin
- (2209763) 2209763..2209829 + 67 NuclAT_36 - Antitoxin
- (2209763) 2209763..2209829 + 67 NuclAT_36 - Antitoxin
- (2209763) 2209763..2209829 + 67 NuclAT_38 - Antitoxin
- (2209763) 2209763..2209829 + 67 NuclAT_38 - Antitoxin
- (2209763) 2209763..2209829 + 67 NuclAT_38 - Antitoxin
- (2209763) 2209763..2209829 + 67 NuclAT_38 - Antitoxin
- (2209763) 2209763..2209829 + 67 NuclAT_43 - Antitoxin
- (2209763) 2209763..2209829 + 67 NuclAT_43 - Antitoxin
- (2209763) 2209763..2209829 + 67 NuclAT_43 - Antitoxin
- (2209763) 2209763..2209829 + 67 NuclAT_43 - Antitoxin
M5S87_RS10605 (2210143) 2210143..2210250 - 108 WP_000170955.1 type I toxin-antitoxin system toxin Ldr family protein -
- (2210303) 2210303..2210364 + 62 NuclAT_45 - -
- (2210303) 2210303..2210364 + 62 NuclAT_45 - -
- (2210303) 2210303..2210364 + 62 NuclAT_45 - -
- (2210303) 2210303..2210364 + 62 NuclAT_45 - -
- (2210303) 2210303..2210364 + 62 NuclAT_47 - -
- (2210303) 2210303..2210364 + 62 NuclAT_47 - -
- (2210303) 2210303..2210364 + 62 NuclAT_47 - -
- (2210303) 2210303..2210364 + 62 NuclAT_47 - -
- (2210303) 2210303..2210365 + 63 NuclAT_22 - -
- (2210303) 2210303..2210365 + 63 NuclAT_22 - -
- (2210303) 2210303..2210365 + 63 NuclAT_22 - -
- (2210303) 2210303..2210365 + 63 NuclAT_22 - -
- (2210303) 2210303..2210365 + 63 NuclAT_27 - -
- (2210303) 2210303..2210365 + 63 NuclAT_27 - -
- (2210303) 2210303..2210365 + 63 NuclAT_27 - -
- (2210303) 2210303..2210365 + 63 NuclAT_27 - -
- (2210303) 2210303..2210365 + 63 NuclAT_32 - -
- (2210303) 2210303..2210365 + 63 NuclAT_32 - -
- (2210303) 2210303..2210365 + 63 NuclAT_32 - -
- (2210303) 2210303..2210365 + 63 NuclAT_32 - -
- (2210303) 2210303..2210365 + 63 NuclAT_37 - -
- (2210303) 2210303..2210365 + 63 NuclAT_37 - -
- (2210303) 2210303..2210365 + 63 NuclAT_37 - -
- (2210303) 2210303..2210365 + 63 NuclAT_37 - -
- (2210303) 2210303..2210365 + 63 NuclAT_39 - -
- (2210303) 2210303..2210365 + 63 NuclAT_39 - -
- (2210303) 2210303..2210365 + 63 NuclAT_39 - -
- (2210303) 2210303..2210365 + 63 NuclAT_39 - -
- (2210303) 2210303..2210365 + 63 NuclAT_44 - -
- (2210303) 2210303..2210365 + 63 NuclAT_44 - -
- (2210303) 2210303..2210365 + 63 NuclAT_44 - -
- (2210303) 2210303..2210365 + 63 NuclAT_44 - -
M5S87_RS10610 (2210656) 2210656..2211756 - 1101 WP_001309461.1 sodium-potassium/proton antiporter ChaA -
M5S87_RS10615 (2212026) 2212026..2212256 + 231 WP_001146444.1 putative cation transport regulator ChaB -
M5S87_RS10620 (2212414) 2212414..2213109 + 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -
M5S87_RS10625 (2213153) 2213153..2213506 - 354 WP_001169659.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4031.79 Da        Isoelectric Point: 11.4779

>T256325 WP_000176713.1 NZ_CP103718:c2209715-2209608 [Escherichia coli]
MTLTQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

Antitoxin


Download         Length: 67 bp

>AT256325 NZ_CP103718:2209763-2209829 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTATACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A229AEQ8

Antitoxin

Download structure file

References