Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 1163427..1164154 | Replicon | chromosome |
Accession | NZ_CP103718 | ||
Organism | Escherichia coli strain 1579 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A829L2T9 |
Locus tag | M5S87_RS05570 | Protein ID | WP_001521139.1 |
Coordinates | 1163427..1163738 (+) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | M5S87_RS05575 | Protein ID | WP_000126294.1 |
Coordinates | 1163735..1164154 (+) | Length | 140 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5S87_RS05545 (1159362) | 1159362..1161071 | + | 1710 | WP_001521140.1 | formate hydrogenlyase subunit HycE | - |
M5S87_RS05550 (1161081) | 1161081..1161623 | + | 543 | WP_000493785.1 | formate hydrogenlyase subunit HycF | - |
M5S87_RS05555 (1161623) | 1161623..1162390 | + | 768 | WP_000067399.1 | formate hydrogenlyase subunit HycG | - |
M5S87_RS05560 (1162387) | 1162387..1162797 | + | 411 | WP_001291918.1 | formate hydrogenlyase assembly protein HycH | - |
M5S87_RS05565 (1162790) | 1162790..1163260 | + | 471 | WP_000132961.1 | hydrogenase maturation peptidase HycI | - |
M5S87_RS05570 (1163427) | 1163427..1163738 | + | 312 | WP_001521139.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
M5S87_RS05575 (1163735) | 1163735..1164154 | + | 420 | WP_000126294.1 | helix-turn-helix domain-containing protein | Antitoxin |
M5S87_RS05580 (1164233) | 1164233..1165657 | - | 1425 | WP_020234028.1 | 6-phospho-beta-glucosidase AscB | - |
M5S87_RS05585 (1165666) | 1165666..1167123 | - | 1458 | WP_020234027.1 | PTS cellobiose/arbutin/salicin transporter subunit IIBC | - |
M5S87_RS05590 (1167383) | 1167383..1168393 | + | 1011 | WP_015912547.1 | DNA-binding transcriptional regulator AscG | - |
M5S87_RS05595 (1168542) | 1168542..1169069 | + | 528 | WP_001078777.1 | electron transport protein HydN | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12493.23 Da Isoelectric Point: 9.4783
>T256323 WP_001521139.1 NZ_CP103718:1163427-1163738 [Escherichia coli]
MHIISKAPFEECARKYPNDALALYSLYRVIKETDFSTPEEMRTAFPNLDNFRYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
MHIISKAPFEECARKYPNDALALYSLYRVIKETDFSTPEEMRTAFPNLDNFRYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15416.42 Da Isoelectric Point: 4.4596
>AT256323 WP_000126294.1 NZ_CP103718:1163735-1164154 [Escherichia coli]
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLASRIAEYENNNEKFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLASRIAEYENNNEKFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|