Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 629881..630680 | Replicon | chromosome |
Accession | NZ_CP103718 | ||
Organism | Escherichia coli strain 1579 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | D3GWU5 |
Locus tag | M5S87_RS03015 | Protein ID | WP_000347272.1 |
Coordinates | 629881..630345 (-) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1EB98 |
Locus tag | M5S87_RS03020 | Protein ID | WP_001307405.1 |
Coordinates | 630345..630680 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5S87_RS02985 (624882) | 624882..625316 | - | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
M5S87_RS02990 (625334) | 625334..626212 | - | 879 | WP_001298314.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
M5S87_RS02995 (626202) | 626202..626981 | - | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
M5S87_RS03000 (626992) | 626992..627465 | - | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
M5S87_RS03005 (627488) | 627488..628768 | - | 1281 | WP_001521382.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
M5S87_RS03010 (629017) | 629017..629826 | + | 810 | WP_000072171.1 | aga operon transcriptional regulator AgaR | - |
M5S87_RS03015 (629881) | 629881..630345 | - | 465 | WP_000347272.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
M5S87_RS03020 (630345) | 630345..630680 | - | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
M5S87_RS03025 (630829) | 630829..632400 | - | 1572 | WP_001273738.1 | galactarate dehydratase | - |
M5S87_RS03030 (632775) | 632775..634109 | + | 1335 | WP_000599651.1 | galactarate/glucarate/glycerate transporter GarP | - |
M5S87_RS03035 (634125) | 634125..634895 | + | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 629881..641332 | 11451 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17832.26 Da Isoelectric Point: 9.6924
>T256318 WP_000347272.1 NZ_CP103718:c630345-629881 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEEPH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEEPH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829KUD2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XVC7 |