Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/Tad-HTH_37 |
| Location | 3832543..3833140 | Replicon | chromosome |
| Accession | NZ_CP103714 | ||
| Organism | Klebsiella pneumoniae strain ST15 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | R4YIC5 |
| Locus tag | M5T51_RS18710 | Protein ID | WP_004142563.1 |
| Coordinates | 3832823..3833140 (-) | Length | 106 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | R4YH91 |
| Locus tag | M5T51_RS18705 | Protein ID | WP_004142561.1 |
| Coordinates | 3832543..3832830 (-) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5T51_RS18675 (3828623) | 3828623..3828871 | + | 249 | WP_020325243.1 | DUF1158 domain-containing protein | - |
| M5T51_RS18680 (3828889) | 3828889..3829230 | - | 342 | WP_002893035.1 | RamA family antibiotic efflux transcriptional regulator | - |
| M5T51_RS18685 (3829261) | 3829261..3830376 | - | 1116 | WP_020325248.1 | MBL fold metallo-hydrolase | - |
| M5T51_RS18690 (3830556) | 3830556..3831137 | + | 582 | WP_020325240.1 | TetR/AcrR family transcriptional regulator | - |
| M5T51_RS18695 (3831137) | 3831137..3831505 | + | 369 | WP_020325252.1 | MmcQ/YjbR family DNA-binding protein | - |
| M5T51_RS18700 (3831625) | 3831625..3832278 | + | 654 | WP_004178896.1 | oxygen-insensitive NAD(P)H nitroreductase | - |
| M5T51_RS18705 (3832543) | 3832543..3832830 | - | 288 | WP_004142561.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| M5T51_RS18710 (3832823) | 3832823..3833140 | - | 318 | WP_004142563.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| M5T51_RS18715 (3833325) | 3833325..3834368 | - | 1044 | WP_020325241.1 | DUF2157 domain-containing protein | - |
| M5T51_RS18720 (3835038) | 3835038..3835904 | - | 867 | WP_004151823.1 | helix-turn-helix transcriptional regulator | - |
| M5T51_RS18725 (3836013) | 3836013..3837440 | + | 1428 | WP_009308097.1 | MFS transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12110.39 Da Isoelectric Point: 11.2767
>T256311 WP_004142563.1 NZ_CP103714:c3833140-3832823 [Klebsiella pneumoniae]
MFRLVVHVDVKKELQALPPIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
MFRLVVHVDVKKELQALPPIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0M5MXH8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0S3DIQ1 |