Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 323139..323725 Replicon chromosome
Accession NZ_CP103714
Organism Klebsiella pneumoniae strain ST15

Toxin (Protein)


Gene name doc Uniprot ID W8VD46
Locus tag M5T51_RS01505 Protein ID WP_002920800.1
Coordinates 323357..323725 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag M5T51_RS01500 Protein ID WP_004174006.1
Coordinates 323139..323360 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5T51_RS01480 (319296) 319296..320222 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
M5T51_RS01485 (320219) 320219..321496 + 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
M5T51_RS01490 (321493) 321493..322260 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
M5T51_RS01495 (322262) 322262..322975 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
M5T51_RS01500 (323139) 323139..323360 + 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
M5T51_RS01505 (323357) 323357..323725 + 369 WP_002920800.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
M5T51_RS01510 (323998) 323998..325314 + 1317 WP_004174008.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
M5T51_RS01515 (325421) 325421..326308 + 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
M5T51_RS01520 (326305) 326305..327150 + 846 WP_004181473.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
M5T51_RS01525 (327152) 327152..328222 + 1071 WP_004150074.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 320219..328959 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13552.92 Da        Isoelectric Point: 8.6410

>T256303 WP_002920800.1 NZ_CP103714:323357-323725 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT256303 WP_004174006.1 NZ_CP103714:323139-323360 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GUD1

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References