Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 59663..59916 | Replicon | plasmid pMB3266_2 |
| Accession | NZ_CP103712 | ||
| Organism | Escherichia coli O25b:H4-ST131 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | A0A148HBD8 |
| Locus tag | M5S69_RS25590 | Protein ID | WP_001336447.1 |
| Coordinates | 59767..59916 (+) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 59663..59719 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5S69_RS25560 (55575) | 55575..56321 | + | 747 | WP_019842127.1 | conjugal transfer pilus acetylase TraX | - |
| M5S69_RS25565 (56376) | 56376..56933 | + | 558 | WP_000139329.1 | fertility inhibition protein FinO | - |
| M5S69_RS25570 (57085) | 57085..57288 | + | 204 | WP_001336517.1 | hypothetical protein | - |
| M5S69_RS25575 (58030) | 58030..58491 | + | 462 | WP_019842128.1 | thermonuclease family protein | - |
| M5S69_RS25580 (58760) | 58760..58978 | + | 219 | WP_023150739.1 | hypothetical protein | - |
| M5S69_RS25585 (59131) | 59131..59568 | + | 438 | WP_000872609.1 | hypothetical protein | - |
| - (59663) | 59663..59719 | - | 57 | NuclAT_2 | - | Antitoxin |
| - (59663) | 59663..59719 | - | 57 | NuclAT_2 | - | Antitoxin |
| - (59663) | 59663..59719 | - | 57 | NuclAT_2 | - | Antitoxin |
| - (59663) | 59663..59719 | - | 57 | NuclAT_2 | - | Antitoxin |
| M5S69_RS25590 (59767) | 59767..59916 | + | 150 | WP_001336447.1 | Hok/Gef family protein | Toxin |
| M5S69_RS25595 (60201) | 60201..60458 | + | 258 | WP_000084404.1 | replication regulatory protein RepA | - |
| M5S69_RS25600 (60694) | 60694..60768 | + | 75 | WP_001365705.1 | RepA leader peptide Tap | - |
| M5S69_RS25605 (60761) | 60761..61618 | + | 858 | WP_000130646.1 | incFII family plasmid replication initiator RepA | - |
| M5S69_RS25610 (62531) | 62531..62668 | + | 138 | Protein_79 | XRE family transcriptional regulator | - |
| M5S69_RS25615 (62688) | 62688..62951 | + | 264 | WP_001089473.1 | hypothetical protein | - |
| M5S69_RS25620 (62941) | 62941..63240 | + | 300 | WP_001528606.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| M5S69_RS25625 (63276) | 63276..63941 | - | 666 | WP_001535733.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaTEM-1B | - | 1..81007 | 81007 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5572.69 Da Isoelectric Point: 8.7678
>T256298 WP_001336447.1 NZ_CP103712:59767-59916 [Escherichia coli O25b:H4-ST131]
MTKYTLIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYTLIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 57 bp
>AT256298 NZ_CP103712:c59719-59663 [Escherichia coli O25b:H4-ST131]
GTACTTCATGCAGGCCTCACGAGTTAATGGATTAACAAGTGGGGTCTTCGCATTTCT
GTACTTCATGCAGGCCTCACGAGTTAATGGATTAACAAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
