Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/COG4683-HTH_37
Location 130184..130841 Replicon plasmid pMB3266_1
Accession NZ_CP103711
Organism Escherichia coli O25b:H4-ST131

Toxin (Protein)


Gene name higB Uniprot ID U3PDC3
Locus tag M5S69_RS24895 Protein ID WP_000270043.1
Coordinates 130184..130534 (+) Length 117 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag M5S69_RS24900 Protein ID WP_000124640.1
Coordinates 130539..130841 (+) Length 101 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5S69_RS24860 (M5S69_24860) 126658..127155 - 498 WP_000062185.1 hypothetical protein -
M5S69_RS24865 (M5S69_24865) 127158..127646 - 489 WP_001273096.1 DUF1643 domain-containing protein -
M5S69_RS24870 (M5S69_24870) 127743..128078 + 336 WP_000683476.1 hypothetical protein -
M5S69_RS24875 (M5S69_24875) 128093..128563 - 471 WP_001281821.1 hypothetical protein -
M5S69_RS24880 (M5S69_24880) 128556..128927 - 372 WP_000516916.1 hypothetical protein -
M5S69_RS24885 (M5S69_24885) 128938..129132 - 195 WP_000343597.1 hypothetical protein -
M5S69_RS24890 (M5S69_24890) 129473..130021 - 549 WP_001061574.1 transcriptional regulator -
M5S69_RS24895 (M5S69_24895) 130184..130534 + 351 WP_000270043.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
M5S69_RS24900 (M5S69_24900) 130539..130841 + 303 WP_000124640.1 XRE family transcriptional regulator Antitoxin
M5S69_RS24905 (M5S69_24905) 130868..131161 - 294 WP_001239997.1 chromosome segregation protein ParM -
M5S69_RS24910 (M5S69_24910) 131249..131521 - 273 WP_001043047.1 HU family DNA-binding protein -
M5S69_RS24915 (M5S69_24915) 131579..132106 - 528 WP_001236377.1 thermonuclease family protein -
M5S69_RS24920 (M5S69_24920) 132123..132311 - 189 WP_001270411.1 hypothetical protein -
M5S69_RS24925 (M5S69_24925) 132337..133194 - 858 WP_001167032.1 hypothetical protein -
M5S69_RS24930 (M5S69_24930) 133181..133411 - 231 WP_000972663.1 hypothetical protein -
M5S69_RS24935 (M5S69_24935) 133411..133929 - 519 WP_000210756.1 nitrite reductase -
M5S69_RS24940 (M5S69_24940) 133926..134372 - 447 WP_000919345.1 Fe3+-siderophore ABC transporter permease -
M5S69_RS24945 (M5S69_24945) 134372..134731 - 360 WP_000422768.1 hypothetical protein -
M5S69_RS24950 (M5S69_24950) 134788..135216 - 429 WP_000591074.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaKPC-2 / blaTEM-1A / blaOXA-9 - 1..178234 178234


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-like

(12-106)

Antitoxin

Cro/C1-type helix-turn-helix domain

(33-79)


Sequences

Toxin        


Download         Length: 117 a.a.        Molecular weight: 13328.21 Da        Isoelectric Point: 5.2421

>T256294 WP_000270043.1 NZ_CP103711:130184-130534 [Escherichia coli O25b:H4-ST131]
MWVIETTDTFDEWFDALDDTDRANVLASMMVLRDRGPMLSRPYADTVNGSSYSNMKELRVQSKGDPIRAFFAFDPKRKGI
LLCAGNKTGDEKRFYEVMIPIADREFAAHLDKLKKE

Download         Length: 351 bp

Antitoxin


Download         Length: 101 a.a.        Molecular weight: 11006.73 Da        Isoelectric Point: 7.2036

>AT256294 WP_000124640.1 NZ_CP103711:130539-130841 [Escherichia coli O25b:H4-ST131]
MARTLDQMLATEKPEVVAKAQKAATEMLLNIHLAELRDRMNLTQGEIAASLGVRQPTVSEMEKPGRDLKLSSIKRYVEAS
GGKLRLDVELPDGTHYGFAV

Download         Length: 303 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7G8AFB9

Antitoxin

Source ID Structure

References