Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yefM-yoeB (relBE)/YoeB-YefM |
| Location | 1764636..1765138 | Replicon | chromosome |
| Accession | NZ_CP103710 | ||
| Organism | Escherichia coli O25b:H4-ST131 | ||
Toxin (Protein)
| Gene name | yoeB | Uniprot ID | E2QNP2 |
| Locus tag | M5S69_RS08315 | Protein ID | WP_000767819.1 |
| Coordinates | 1764884..1765138 (+) | Length | 85 a.a. |
Antitoxin (Protein)
| Gene name | yefM | Uniprot ID | E2QNP3 |
| Locus tag | M5S69_RS08310 | Protein ID | WP_001259253.1 |
| Coordinates | 1764636..1764887 (+) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5S69_RS08285 (1759814) | 1759814..1760881 | - | 1068 | WP_000080057.1 | bifunctional histidinol-phosphatase/imidazoleglycerol-phosphate dehydratase HisB | - |
| M5S69_RS08290 (1760881) | 1760881..1761951 | - | 1071 | WP_000108967.1 | histidinol-phosphate transaminase | - |
| M5S69_RS08295 (1761948) | 1761948..1763252 | - | 1305 | WP_001296211.1 | histidinol dehydrogenase | - |
| M5S69_RS08300 (1763258) | 1763258..1764157 | - | 900 | WP_000131782.1 | ATP phosphoribosyltransferase | - |
| M5S69_RS08305 (1764303) | 1764303..1764353 | - | 51 | WP_001364200.1 | his operon leader peptide | - |
| M5S69_RS08310 (1764636) | 1764636..1764887 | + | 252 | WP_001259253.1 | YoeB-YefM toxin-antitoxin system antitoxin YefM | Antitoxin |
| M5S69_RS08315 (1764884) | 1764884..1765138 | + | 255 | WP_000767819.1 | type II toxin-antitoxin system mRNA interferase toxin YoeB | Toxin |
| M5S69_RS08320 (1765221) | 1765221..1766045 | + | 825 | WP_000754737.1 | SDR family oxidoreductase | - |
| M5S69_RS08325 (1766091) | 1766091..1767020 | + | 930 | WP_000803366.1 | LysR substrate-binding domain-containing protein | - |
| M5S69_RS08330 (1767235) | 1767235..1767297 | + | 63 | WP_010723108.1 | membrane protein YoeI | - |
| M5S69_RS08335 (1767287) | 1767287..1768645 | + | 1359 | WP_000019194.1 | putrescine/proton symporter PlaP | - |
| M5S69_RS08340 (1768862) | 1768862..1769320 | + | 459 | WP_001531805.1 | IS200/IS605-like element IS200C family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 1768862..1769320 | 458 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 85 a.a. Molecular weight: 10110.53 Da Isoelectric Point: 7.2749
>T256279 WP_000767819.1 NZ_CP103710:1764884-1765138 [Escherichia coli O25b:H4-ST131]
VKLIWSEESWDDYLYWQEADKRIVKKINELIKDTRRTPFEGKGKPEPLKHNLSGFWSRRITEEHLLVYAVTDDSLLIAAC
RYHY
VKLIWSEESWDDYLYWQEADKRIVKKINELIKDTRRTPFEGKGKPEPLKHNLSGFWSRRITEEHLLVYAVTDDSLLIAAC
RYHY
Download Length: 255 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|