Detailed information of TA system TA256267

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 17253..17486
• Replicon: plasmid pMB3362_1
• Accession: NZ_CP103705
• Organism: Escherichia coli strain ST361

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: M5T41_RS23360
• Protein ID: WP_001372321.1
• Coordinates: 17361..17486 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	17253..17284 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
M5T41_RS23305 (12484)	12484..12690	+	207	WP_001774176.1	hypothetical protein	-
M5T41_RS23310 (12609)	12609..12860	+	252	WP_071579736.1	hypothetical protein	-
M5T41_RS23315 (13100)	13100..13306	+	207	WP_000275856.1	hypothetical protein	-
M5T41_RS23320 (13332)	13332..13871	+	540	WP_000290840.1	single-stranded DNA-binding protein	-
M5T41_RS23325 (13939)	13939..14172	+	234	WP_000005990.1	DUF905 family protein	-
M5T41_RS23330 (14200)	14200..14397	+	198	Protein_21	hypothetical protein	-
M5T41_RS23335 (14452)	14452..14886	+	435	WP_000845937.1	conjugation system SOS inhibitor PsiB	-
M5T41_RS23340 (14883)	14883..15645	+	763	Protein_23	plasmid SOS inhibition protein A	-
M5T41_RS23345 (15614)	15614..15802	-	189	WP_001299721.1	hypothetical protein	-
- (15614)	15614..15811	+	198	NuclAT_0	-	-
- (15614)	15614..15811	+	198	NuclAT_0	-	-
- (15614)	15614..15811	+	198	NuclAT_0	-	-
- (15614)	15614..15811	+	198	NuclAT_0	-	-
M5T41_RS23350 (15859)	15859..17228	+	1370	WP_085947770.1	IS3-like element IS150 family transposase	-
- (17253)	17253..17284	+	32	NuclAT_1	-	Antitoxin
- (17253)	17253..17284	+	32	NuclAT_1	-	Antitoxin
- (17253)	17253..17284	+	32	NuclAT_1	-	Antitoxin
- (17253)	17253..17284	+	32	NuclAT_1	-	Antitoxin
M5T41_RS23355 (17270)	17270..17419	+	150	Protein_26	plasmid maintenance protein Mok	-
M5T41_RS23360 (17361)	17361..17486	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
M5T41_RS23365 (17706)	17706..17936	+	231	WP_071886920.1	hypothetical protein	-
M5T41_RS23370 (17934)	17934..18106	-	173	Protein_29	hypothetical protein	-
M5T41_RS23375 (18176)	18176..18382	+	207	WP_000547968.1	hypothetical protein	-
M5T41_RS23380 (18407)	18407..18694	+	288	WP_000107535.1	hypothetical protein	-
M5T41_RS23385 (18812)	18812..19633	+	822	WP_001234426.1	DUF932 domain-containing protein	-
M5T41_RS23390 (19930)	19930..20532	-	603	WP_013362798.1	transglycosylase SLT domain-containing protein	-
M5T41_RS23395 (20853)	20853..21236	+	384	WP_001151524.1	conjugal transfer relaxosome DNA-binding protein TraM	-
M5T41_RS23400 (21423)	21423..22112	+	690	WP_000283385.1	conjugal transfer transcriptional regulator TraJ	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	aac(6')-Ib-cr / blaOXA-1 / blaCTX-M-15 / aadA5 / qacE / sul1 / mph(A) / tet(B) / sitABCD	iucA / iucB / iucC / iucD / iutA	1..165827	165827

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T256267 WP_001372321.1 NZ_CP103705:17361-17486 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 32 bp

>AT256267 NZ_CP103705:17253-17284 [Escherichia coli]
CACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin