Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 3782124..3782818 | Replicon | chromosome |
| Accession | NZ_CP103704 | ||
| Organism | Escherichia coli strain ST361 | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | S1EXB8 |
| Locus tag | M5T41_RS18445 | Protein ID | WP_001263493.1 |
| Coordinates | 3782124..3782522 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | S1FJN6 |
| Locus tag | M5T41_RS18450 | Protein ID | WP_000554757.1 |
| Coordinates | 3782525..3782818 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| - (3777784) | 3777784..3777864 | - | 81 | NuclAT_11 | - | - |
| - (3777784) | 3777784..3777864 | - | 81 | NuclAT_11 | - | - |
| - (3777784) | 3777784..3777864 | - | 81 | NuclAT_11 | - | - |
| - (3777784) | 3777784..3777864 | - | 81 | NuclAT_11 | - | - |
| M5T41_RS18415 (3777124) | 3777124..3778368 | - | 1245 | WP_000189541.1 | esterase FrsA | - |
| M5T41_RS18420 (3778460) | 3778460..3778918 | - | 459 | WP_061349133.1 | xanthine phosphoribosyltransferase | - |
| M5T41_RS18425 (3779179) | 3779179..3780636 | + | 1458 | WP_001293003.1 | cytosol nonspecific dipeptidase | - |
| M5T41_RS18430 (3780693) | 3780693..3781214 | - | 522 | Protein_3610 | peptide chain release factor H | - |
| M5T41_RS18435 (3781213) | 3781213..3781416 | - | 204 | Protein_3611 | RtcB family protein | - |
| M5T41_RS18440 (3781662) | 3781662..3782114 | - | 453 | WP_001059847.1 | GNAT family N-acetyltransferase | - |
| M5T41_RS18445 (3782124) | 3782124..3782522 | - | 399 | WP_001263493.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
| M5T41_RS18450 (3782525) | 3782525..3782818 | - | 294 | WP_000554757.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| M5T41_RS18455 (3782870) | 3782870..3783925 | - | 1056 | WP_001226164.1 | DNA polymerase IV | - |
| M5T41_RS18460 (3783996) | 3783996..3784781 | - | 786 | WP_000207564.1 | putative lateral flagellar export/assembly protein LafU | - |
| M5T41_RS18465 (3784753) | 3784753..3786465 | + | 1713 | Protein_3617 | flagellar biosynthesis protein FlhA | - |
| M5T41_RS18470 (3786689) | 3786689..3787186 | - | 498 | WP_000006255.1 | REP-associated tyrosine transposase RayT | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15472.83 Da Isoelectric Point: 8.0949
>T256263 WP_001263493.1 NZ_CP103704:c3782522-3782124 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|