Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
Location | 752616..753309 | Replicon | chromosome |
Accession | NZ_CP103704 | ||
Organism | Escherichia coli strain ST361 |
Toxin (Protein)
Gene name | mqsR | Uniprot ID | S1EZG2 |
Locus tag | M5T41_RS03635 | Protein ID | WP_000415584.1 |
Coordinates | 752616..752912 (+) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | mqsA | Uniprot ID | S1EBV2 |
Locus tag | M5T41_RS03640 | Protein ID | WP_000650107.1 |
Coordinates | 752914..753309 (+) | Length | 132 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5T41_RS03600 (747704) | 747704..748018 | - | 315 | WP_000958598.1 | putative quinol monooxygenase | - |
M5T41_RS03605 (748049) | 748049..748630 | - | 582 | WP_000065430.1 | NADPH:quinone oxidoreductase MdaB | - |
M5T41_RS03610 (748949) | 748949..749281 | + | 333 | WP_000917684.1 | DUF2645 family protein | - |
M5T41_RS03615 (749327) | 749327..750676 | - | 1350 | WP_000673402.1 | quorum sensing histidine kinase QseC | - |
M5T41_RS03620 (750673) | 750673..751332 | - | 660 | WP_001221493.1 | quorum sensing response regulator transcription factor QseB | - |
M5T41_RS03625 (751484) | 751484..751876 | + | 393 | WP_000712658.1 | OB fold stress tolerance protein YgiW | - |
M5T41_RS03630 (751929) | 751929..752411 | + | 483 | WP_000183505.1 | GyrI-like domain-containing protein | - |
M5T41_RS03635 (752616) | 752616..752912 | + | 297 | WP_000415584.1 | type II toxin-antitoxin system toxin MqsR | Toxin |
M5T41_RS03640 (752914) | 752914..753309 | + | 396 | WP_000650107.1 | type II toxin-antitoxin system antitoxin MqsA | Antitoxin |
M5T41_RS03645 (753442) | 753442..755049 | + | 1608 | WP_064221462.1 | ABC transporter substrate-binding protein | - |
M5T41_RS03650 (755187) | 755187..757445 | + | 2259 | WP_104763973.1 | DNA topoisomerase IV subunit A | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11231.96 Da Isoelectric Point: 8.9070
>T256250 WP_000415584.1 NZ_CP103704:752616-752912 [Escherichia coli]
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
Download Length: 297 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14703.10 Da Isoelectric Point: 9.2136
>AT256250 WP_000650107.1 NZ_CP103704:752914-753309 [Escherichia coli]
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|