Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 639617..640416 | Replicon | chromosome |
| Accession | NZ_CP103704 | ||
| Organism | Escherichia coli strain ST361 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | S1NYM6 |
| Locus tag | M5T41_RS03085 | Protein ID | WP_000347251.1 |
| Coordinates | 639617..640081 (-) | Length | 155 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | D6JF08 |
| Locus tag | M5T41_RS03090 | Protein ID | WP_001308975.1 |
| Coordinates | 640081..640416 (-) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5T41_RS03055 (634618) | 634618..635052 | - | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
| M5T41_RS03060 (635070) | 635070..635948 | - | 879 | WP_001300474.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
| M5T41_RS03065 (635938) | 635938..636717 | - | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
| M5T41_RS03070 (636728) | 636728..637201 | - | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
| M5T41_RS03075 (637224) | 637224..638504 | - | 1281 | WP_000681920.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
| M5T41_RS03080 (638753) | 638753..639562 | + | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
| M5T41_RS03085 (639617) | 639617..640081 | - | 465 | WP_000347251.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
| M5T41_RS03090 (640081) | 640081..640416 | - | 336 | WP_001308975.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
| M5T41_RS03095 (640565) | 640565..642136 | - | 1572 | WP_064221457.1 | galactarate dehydratase | - |
| M5T41_RS03100 (642511) | 642511..643845 | + | 1335 | WP_000599636.1 | galactarate/glucarate/glycerate transporter GarP | - |
| M5T41_RS03105 (643861) | 643861..644631 | + | 771 | WP_001058209.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17777.14 Da Isoelectric Point: 9.4947
>T256248 WP_000347251.1 NZ_CP103704:c640081-639617 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CJ20 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | D6JF08 |