Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/RelE-HTH |
| Location | 2399779..2400468 | Replicon | chromosome |
| Accession | NZ_CP103699 | ||
| Organism | Klebsiella pneumoniae strain ST307 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A331C6E2 |
| Locus tag | M5R30_RS11760 | Protein ID | WP_021469727.1 |
| Coordinates | 2399779..2400096 (+) | Length | 106 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A6B0N7G3 |
| Locus tag | M5R30_RS11765 | Protein ID | WP_020804705.1 |
| Coordinates | 2400172..2400468 (+) | Length | 99 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5R30_RS11730 (2395481) | 2395481..2395990 | + | 510 | WP_020802144.1 | GNAT family N-acetyltransferase | - |
| M5R30_RS11735 (2396000) | 2396000..2396926 | + | 927 | WP_032435210.1 | amino acid ABC transporter permease | - |
| M5R30_RS11740 (2396910) | 2396910..2397689 | + | 780 | WP_002906697.1 | amino acid ABC transporter ATP-binding protein | - |
| M5R30_RS11745 (2397728) | 2397728..2398579 | + | 852 | WP_072198177.1 | transporter substrate-binding domain-containing protein | - |
| M5R30_RS11750 (2398657) | 2398657..2399274 | + | 618 | WP_032425015.1 | glutathione S-transferase family protein | - |
| M5R30_RS11755 (2399345) | 2399345..2399572 | + | 228 | WP_002906690.1 | tautomerase PptA | - |
| M5R30_RS11760 (2399779) | 2399779..2400096 | + | 318 | WP_021469727.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| M5R30_RS11765 (2400172) | 2400172..2400468 | + | 297 | WP_020804705.1 | NadS family protein | Antitoxin |
| M5R30_RS11770 (2400547) | 2400547..2400993 | + | 447 | WP_032435212.1 | hypothetical protein | - |
| M5R30_RS11775 (2401034) | 2401034..2402650 | - | 1617 | WP_004175961.1 | carbohydrate porin | - |
| M5R30_RS11780 (2402694) | 2402694..2404076 | - | 1383 | WP_004151222.1 | MFS transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12221.10 Da Isoelectric Point: 10.2217
>T256239 WP_021469727.1 NZ_CP103699:2399779-2400096 [Klebsiella pneumoniae]
MLTFIELQGFSKRRQVLLQDDEFRAFQEILINDPEAGDTISGTGGFRKIRWSRPGMGKRGGVRVIYYNVTKKGRIYLALI
YPKNEQDELNQEQKKMLRQVADLIN
MLTFIELQGFSKRRQVLLQDDEFRAFQEILINDPEAGDTISGTGGFRKIRWSRPGMGKRGGVRVIYYNVTKKGRIYLALI
YPKNEQDELNQEQKKMLRQVADLIN
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A331C6E2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6B0N7G3 |