Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 349412..350058 | Replicon | chromosome |
| Accession | NZ_CP103699 | ||
| Organism | Klebsiella pneumoniae strain ST307 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | W9BBY1 |
| Locus tag | M5R30_RS01615 | Protein ID | WP_016529833.1 |
| Coordinates | 349412..349759 (+) | Length | 116 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | W8UB68 |
| Locus tag | M5R30_RS01620 | Protein ID | WP_002920557.1 |
| Coordinates | 349759..350058 (+) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5R30_RS01605 (345348) | 345348..346781 | + | 1434 | WP_002920564.1 | glycogen synthase GlgA | - |
| M5R30_RS01610 (346799) | 346799..349246 | + | 2448 | WP_002920561.1 | glycogen phosphorylase | - |
| M5R30_RS01615 (349412) | 349412..349759 | + | 348 | WP_016529833.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| M5R30_RS01620 (349759) | 349759..350058 | + | 300 | WP_002920557.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| M5R30_RS01625 (350121) | 350121..351629 | - | 1509 | WP_002920554.1 | glycerol-3-phosphate dehydrogenase | - |
| M5R30_RS01630 (351834) | 351834..352163 | + | 330 | WP_002920552.1 | thiosulfate sulfurtransferase GlpE | - |
| M5R30_RS01635 (352214) | 352214..353044 | + | 831 | WP_004151408.1 | rhomboid family intramembrane serine protease GlpG | - |
| M5R30_RS01640 (353094) | 353094..353852 | + | 759 | WP_002920548.1 | DeoR/GlpR family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 13549.56 Da Isoelectric Point: 5.6749
>T256233 WP_016529833.1 NZ_CP103699:349412-349759 [Klebsiella pneumoniae]
MWDVETTDTFDTWFELQSRALKEDMLATMLILSEFAPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRAFFAFDPLRKAI
VLCAGDKDGMNEKRFYKEMITLADREFSQHLTKER
MWDVETTDTFDTWFELQSRALKEDMLATMLILSEFAPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRAFFAFDPLRKAI
VLCAGDKDGMNEKRFYKEMITLADREFSQHLTKER
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | W9BBY1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E1CBF8 |