Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 4599312..4599958 | Replicon | chromosome |
| Accession | NZ_CP103697 | ||
| Organism | Klebsiella pneumoniae strain ST3576 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | M5R27_RS22090 | Protein ID | WP_032415766.1 |
| Coordinates | 4599312..4599659 (+) | Length | 116 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | W8UB68 |
| Locus tag | M5R27_RS22095 | Protein ID | WP_002920557.1 |
| Coordinates | 4599659..4599958 (+) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5R27_RS22080 (M5R27_22080) | 4595238..4596671 | + | 1434 | WP_002920564.1 | glycogen synthase GlgA | - |
| M5R27_RS22085 (M5R27_22085) | 4596689..4599136 | + | 2448 | WP_002920561.1 | glycogen phosphorylase | - |
| M5R27_RS22090 (M5R27_22090) | 4599312..4599659 | + | 348 | WP_032415766.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| M5R27_RS22095 (M5R27_22095) | 4599659..4599958 | + | 300 | WP_002920557.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| M5R27_RS22100 (M5R27_22100) | 4600021..4601529 | - | 1509 | WP_002920554.1 | glycerol-3-phosphate dehydrogenase | - |
| M5R27_RS22105 (M5R27_22105) | 4601734..4602063 | + | 330 | WP_002920552.1 | thiosulfate sulfurtransferase GlpE | - |
| M5R27_RS22110 (M5R27_22110) | 4602114..4602944 | + | 831 | WP_004151408.1 | rhomboid family intramembrane serine protease GlpG | - |
| M5R27_RS22115 (M5R27_22115) | 4602994..4603752 | + | 759 | WP_002920548.1 | DeoR/GlpR family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 13535.49 Da Isoelectric Point: 5.2054
>T256229 WP_032415766.1 NZ_CP103697:4599312-4599659 [Klebsiella pneumoniae]
MWDVETTDTFDTWFELQSRALKEDMLATMLILSEFAPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRAFFAFDPLRKAI
VLCAGDKDGMNENRFYKEMITLADREFSQHLTKER
MWDVETTDTFDTWFELQSRALKEDMLATMLILSEFAPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRAFFAFDPLRKAI
VLCAGDKDGMNENRFYKEMITLADREFSQHLTKER
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|