Detailed information of TA system TA256213

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 99621..100047
• Replicon: plasmid pMB3825A_1
• Accession: NZ_CP103695
• Organism: Escherichia coli strain ST12468

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: M5T31_RS23250
• Protein ID: WP_001372321.1
• Coordinates: 99621..99746 (-)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	99823..100047 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
M5T31_RS23205 (94666)	94666..94893	-	228	WP_001254386.1	conjugal transfer relaxosome protein TraY	-
M5T31_RS23210 (94987)	94987..95673	-	687	WP_000332484.1	PAS domain-containing protein	-
M5T31_RS23215 (95864)	95864..96247	-	384	WP_000124981.1	conjugal transfer relaxosome DNA-binding protein TraM	-
M5T31_RS23220 (96524)	96524..97171	+	648	WP_000614936.1	transglycosylase SLT domain-containing protein	-
M5T31_RS23225 (97468)	97468..98289	-	822	WP_001234469.1	DUF932 domain-containing protein	-
M5T31_RS23230 (98412)	98412..98699	-	288	WP_000107535.1	hypothetical protein	-
M5T31_RS23235 (98724)	98724..98930	-	207	WP_000547939.1	hypothetical protein	-
M5T31_RS23240 (99000)	99000..99173	+	174	Protein_114	hypothetical protein	-
M5T31_RS23245 (99171)	99171..99401	-	231	WP_001426396.1	hypothetical protein	-
M5T31_RS23250 (99621)	99621..99746	-	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
M5T31_RS23255 (99688)	99688..99837	-	150	Protein_117	plasmid maintenance protein Mok	-
- (99823)	99823..100047	-	225	NuclAT_0	-	Antitoxin
- (99823)	99823..100047	-	225	NuclAT_0	-	Antitoxin
- (99823)	99823..100047	-	225	NuclAT_0	-	Antitoxin
- (99823)	99823..100047	-	225	NuclAT_0	-	Antitoxin
M5T31_RS23260 (99859)	99859..100047	+	189	WP_001299721.1	hypothetical protein	-
M5T31_RS23265 (100016)	100016..100778	-	763	Protein_119	plasmid SOS inhibition protein A	-
M5T31_RS23270 (100775)	100775..101209	-	435	WP_000845895.1	conjugation system SOS inhibitor PsiB	-
M5T31_RS23275 (101264)	101264..103222	-	1959	WP_001145469.1	ParB/RepB/Spo0J family partition protein	-
M5T31_RS23280 (103281)	103281..103514	-	234	WP_000006004.1	DUF905 domain-containing protein	-
M5T31_RS23285 (103570)	103570..104097	-	528	WP_000290793.1	single-stranded DNA-binding protein	-
M5T31_RS23290 (104570)	104570..104854	-	285	WP_124767219.1	hypothetical protein	-
M5T31_RS23295 (104740)	104740..105006	-	267	WP_001697809.1	hypothetical protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	aac(3)-IIa / tet(A) / aph(3')-Ia / sitABCD	-	1..128470	128470

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T256213 WP_001372321.1 NZ_CP103695:c99746-99621 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT256213 NZ_CP103695:c100047-99823 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin