Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
Location | 3626890..3627584 | Replicon | chromosome |
Accession | NZ_CP103694 | ||
Organism | Escherichia coli strain ST12468 |
Toxin (Protein)
Gene name | yafO | Uniprot ID | S1EXB8 |
Locus tag | M5T31_RS17845 | Protein ID | WP_001263493.1 |
Coordinates | 3626890..3627288 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | yafN | Uniprot ID | S1FJN6 |
Locus tag | M5T31_RS17850 | Protein ID | WP_000554757.1 |
Coordinates | 3627291..3627584 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
- (3622550) | 3622550..3622630 | - | 81 | NuclAT_9 | - | - |
- (3622550) | 3622550..3622630 | - | 81 | NuclAT_9 | - | - |
- (3622550) | 3622550..3622630 | - | 81 | NuclAT_9 | - | - |
- (3622550) | 3622550..3622630 | - | 81 | NuclAT_9 | - | - |
M5T31_RS17815 (3621890) | 3621890..3623134 | - | 1245 | WP_000189541.1 | esterase FrsA | - |
M5T31_RS17820 (3623226) | 3623226..3623684 | - | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
M5T31_RS17825 (3623945) | 3623945..3625402 | + | 1458 | WP_001293003.1 | cytosol nonspecific dipeptidase | - |
M5T31_RS17830 (3625459) | 3625459..3625980 | - | 522 | Protein_3492 | peptide chain release factor H | - |
M5T31_RS17835 (3625979) | 3625979..3626182 | - | 204 | Protein_3493 | RtcB family protein | - |
M5T31_RS17840 (3626428) | 3626428..3626880 | - | 453 | WP_001059847.1 | GNAT family N-acetyltransferase | - |
M5T31_RS17845 (3626890) | 3626890..3627288 | - | 399 | WP_001263493.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
M5T31_RS17850 (3627291) | 3627291..3627584 | - | 294 | WP_000554757.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
M5T31_RS17855 (3627636) | 3627636..3628691 | - | 1056 | WP_001226164.1 | DNA polymerase IV | - |
M5T31_RS17860 (3628762) | 3628762..3629547 | - | 786 | WP_000207587.1 | putative lateral flagellar export/assembly protein LafU | - |
M5T31_RS17865 (3629492) | 3629492..3631230 | + | 1739 | Protein_3499 | flagellar biosynthesis protein FlhA | - |
M5T31_RS17870 (3631454) | 3631454..3631951 | - | 498 | WP_000006255.1 | REP-associated tyrosine transposase RayT | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | gmhA/lpcA | 3625928..3647045 | 21117 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15472.83 Da Isoelectric Point: 8.0949
>T256208 WP_001263493.1 NZ_CP103694:c3627288-3626890 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|