Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/RelE-HTH |
Location | 2460795..2461484 | Replicon | chromosome |
Accession | NZ_CP103687 | ||
Organism | Klebsiella pneumoniae strain ST307 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A331C6E2 |
Locus tag | M5S48_RS12185 | Protein ID | WP_021469727.1 |
Coordinates | 2460795..2461112 (+) | Length | 106 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A6B0N7G3 |
Locus tag | M5S48_RS12190 | Protein ID | WP_020804705.1 |
Coordinates | 2461188..2461484 (+) | Length | 99 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5S48_RS12155 (2456497) | 2456497..2457006 | + | 510 | WP_020802144.1 | GNAT family N-acetyltransferase | - |
M5S48_RS12160 (2457016) | 2457016..2457942 | + | 927 | WP_032435210.1 | amino acid ABC transporter permease | - |
M5S48_RS12165 (2457926) | 2457926..2458705 | + | 780 | WP_002906697.1 | amino acid ABC transporter ATP-binding protein | - |
M5S48_RS12170 (2458744) | 2458744..2459595 | + | 852 | WP_072198177.1 | transporter substrate-binding domain-containing protein | - |
M5S48_RS12175 (2459673) | 2459673..2460290 | + | 618 | WP_032425015.1 | glutathione S-transferase family protein | - |
M5S48_RS12180 (2460361) | 2460361..2460588 | + | 228 | WP_002906690.1 | tautomerase PptA | - |
M5S48_RS12185 (2460795) | 2460795..2461112 | + | 318 | WP_021469727.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
M5S48_RS12190 (2461188) | 2461188..2461484 | + | 297 | WP_020804705.1 | NadS family protein | Antitoxin |
M5S48_RS12195 (2461563) | 2461563..2462009 | + | 447 | WP_032435212.1 | hypothetical protein | - |
M5S48_RS12200 (2462050) | 2462050..2463666 | - | 1617 | WP_004175961.1 | carbohydrate porin | - |
M5S48_RS12205 (2463710) | 2463710..2465092 | - | 1383 | WP_004151222.1 | MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12221.10 Da Isoelectric Point: 10.2217
>T256186 WP_021469727.1 NZ_CP103687:2460795-2461112 [Klebsiella pneumoniae]
MLTFIELQGFSKRRQVLLQDDEFRAFQEILINDPEAGDTISGTGGFRKIRWSRPGMGKRGGVRVIYYNVTKKGRIYLALI
YPKNEQDELNQEQKKMLRQVADLIN
MLTFIELQGFSKRRQVLLQDDEFRAFQEILINDPEAGDTISGTGGFRKIRWSRPGMGKRGGVRVIYYNVTKKGRIYLALI
YPKNEQDELNQEQKKMLRQVADLIN
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A331C6E2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6B0N7G3 |