Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 323235..323821 Replicon chromosome
Accession NZ_CP103687
Organism Klebsiella pneumoniae strain ST307

Toxin (Protein)


Gene name doc Uniprot ID W8VD46
Locus tag M5S48_RS01505 Protein ID WP_002920800.1
Coordinates 323453..323821 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag M5S48_RS01500 Protein ID WP_004174006.1
Coordinates 323235..323456 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5S48_RS01480 (319392) 319392..320318 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
M5S48_RS01485 (320315) 320315..321592 + 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
M5S48_RS01490 (321589) 321589..322356 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
M5S48_RS01495 (322358) 322358..323071 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
M5S48_RS01500 (323235) 323235..323456 + 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
M5S48_RS01505 (323453) 323453..323821 + 369 WP_002920800.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
M5S48_RS01510 (324094) 324094..325410 + 1317 WP_004174008.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
M5S48_RS01515 (325517) 325517..326404 + 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
M5S48_RS01520 (326401) 326401..327246 + 846 WP_032434559.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
M5S48_RS01525 (327248) 327248..328318 + 1071 WP_004150074.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 320315..329055 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13552.92 Da        Isoelectric Point: 8.6410

>T256179 WP_002920800.1 NZ_CP103687:323453-323821 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT256179 WP_004174006.1 NZ_CP103687:323235-323456 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GUD1

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References