Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 2865509..2866169 | Replicon | chromosome |
| Accession | NZ_CP103679 | ||
| Organism | Enterobacter hormaechei strain MB4528 Variant | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A2J0Q4X0 |
| Locus tag | M5T06_RS13745 | Protein ID | WP_017383312.1 |
| Coordinates | 2865816..2866169 (-) | Length | 118 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A2J0Q4Z7 |
| Locus tag | M5T06_RS13740 | Protein ID | WP_017383313.1 |
| Coordinates | 2865509..2865811 (-) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5T06_RS13725 (M5T06_13725) | 2861683..2863008 | + | 1326 | WP_017383315.1 | SidA/IucD/PvdA family monooxygenase | - |
| M5T06_RS13730 (M5T06_13730) | 2863035..2865224 | + | 2190 | WP_017383314.1 | TonB-dependent siderophore receptor | - |
| M5T06_RS13740 (M5T06_13740) | 2865509..2865811 | - | 303 | WP_017383313.1 | XRE family transcriptional regulator | Antitoxin |
| M5T06_RS13745 (M5T06_13745) | 2865816..2866169 | - | 354 | WP_017383312.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| M5T06_RS13750 (M5T06_13750) | 2866360..2867310 | - | 951 | WP_017383311.1 | HTH-type transcriptional regulator Cbl | - |
| M5T06_RS13755 (M5T06_13755) | 2867407..2868324 | - | 918 | WP_003859531.1 | nitrogen assimilation transcriptional regulator NAC | - |
| M5T06_RS13765 (M5T06_13765) | 2868856..2869788 | - | 933 | WP_032671703.1 | L,D-transpeptidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 118 a.a. Molecular weight: 13537.37 Da Isoelectric Point: 9.9538
>T256152 WP_017383312.1 NZ_CP103679:c2866169-2865816 [Enterobacter hormaechei]
VWAIKTTDRFDDWFTSLNDSERASVLAALLVLRERGPGLSRPYADTLKGSRHSNMKELRIQSKGDPLRAFFAFDPNRTGI
VLCAGNKVGNERRFYDEMLLVADREYTRWLNTLKERN
VWAIKTTDRFDDWFTSLNDSERASVLAALLVLRERGPGLSRPYADTLKGSRHSNMKELRIQSKGDPLRAFFAFDPNRTGI
VLCAGNKVGNERRFYDEMLLVADREYTRWLNTLKERN
Download Length: 354 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2J0Q4X0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2J0Q4Z7 |