Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 4882262..4882864 | Replicon | chromosome |
Accession | NZ_CP103673 | ||
Organism | Escherichia coli strain 4069 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9XIS6 |
Locus tag | M4U10_RS23235 | Protein ID | WP_000897305.1 |
Coordinates | 4882553..4882864 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | M4U10_RS23230 | Protein ID | WP_000356395.1 |
Coordinates | 4882262..4882552 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M4U10_RS23195 (4877886) | 4877886..4878788 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
M4U10_RS23200 (4878785) | 4878785..4879420 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
M4U10_RS23205 (4879417) | 4879417..4880346 | + | 930 | WP_000027720.1 | formate dehydrogenase accessory protein FdhE | - |
M4U10_RS23210 (4880528) | 4880528..4880770 | - | 243 | WP_001309881.1 | CopG family transcriptional regulator | - |
M4U10_RS23215 (4880989) | 4880989..4881207 | - | 219 | WP_001295676.1 | CopG family transcriptional regulator | - |
M4U10_RS23220 (4881626) | 4881626..4881904 | - | 279 | WP_001315112.1 | hypothetical protein | - |
M4U10_RS23225 (4881956) | 4881956..4882177 | - | 222 | WP_001550354.1 | hypothetical protein | - |
M4U10_RS23230 (4882262) | 4882262..4882552 | - | 291 | WP_000356395.1 | NadS family protein | Antitoxin |
M4U10_RS23235 (4882553) | 4882553..4882864 | - | 312 | WP_000897305.1 | hypothetical protein | Toxin |
M4U10_RS23240 (4883093) | 4883093..4884001 | + | 909 | WP_001550353.1 | alpha/beta hydrolase | - |
M4U10_RS23245 (4884169) | 4884169..4885083 | - | 915 | WP_109553727.1 | transposase | - |
M4U10_RS23250 (4885096) | 4885096..4885983 | - | 888 | Protein_4545 | hypothetical protein | - |
M4U10_RS23255 (4886399) | 4886399..4887340 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
M4U10_RS23260 (4887385) | 4887385..4887822 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T256114 WP_000897305.1 NZ_CP103673:c4882864-4882553 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|