Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 3767840..3768567 | Replicon | chromosome |
Accession | NZ_CP103673 | ||
Organism | Escherichia coli strain 4069 |
Toxin (Protein)
Gene name | higB | Uniprot ID | V0YLE2 |
Locus tag | M4U10_RS17890 | Protein ID | WP_000547555.1 |
Coordinates | 3768256..3768567 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | M4U10_RS17885 | Protein ID | WP_000126294.1 |
Coordinates | 3767840..3768259 (-) | Length | 140 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M4U10_RS17865 (3762925) | 3762925..3763452 | - | 528 | WP_001078777.1 | electron transport protein HydN | - |
M4U10_RS17870 (3763601) | 3763601..3764611 | - | 1011 | WP_029130985.1 | DNA-binding transcriptional regulator AscG | - |
M4U10_RS17875 (3764871) | 3764871..3766328 | + | 1458 | WP_001107889.1 | PTS cellobiose/arbutin/salicin transporter subunit IIBC | - |
M4U10_RS17880 (3766337) | 3766337..3767761 | + | 1425 | WP_000110355.1 | 6-phospho-beta-glucosidase AscB | - |
M4U10_RS17885 (3767840) | 3767840..3768259 | - | 420 | WP_000126294.1 | helix-turn-helix domain-containing protein | Antitoxin |
M4U10_RS17890 (3768256) | 3768256..3768567 | - | 312 | WP_000547555.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
M4U10_RS17895 (3768734) | 3768734..3769204 | - | 471 | WP_001551542.1 | hydrogenase maturation peptidase HycI | - |
M4U10_RS17900 (3769197) | 3769197..3769607 | - | 411 | WP_001291918.1 | formate hydrogenlyase assembly protein HycH | - |
M4U10_RS17905 (3769604) | 3769604..3770371 | - | 768 | WP_000067399.1 | formate hydrogenlyase subunit HycG | - |
M4U10_RS17910 (3770371) | 3770371..3770913 | - | 543 | WP_000493785.1 | formate hydrogenlyase subunit HycF | - |
M4U10_RS17915 (3770923) | 3770923..3772632 | - | 1710 | WP_001288122.1 | formate hydrogenlyase subunit HycE | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12439.18 Da Isoelectric Point: 9.5146
>T256107 WP_000547555.1 NZ_CP103673:c3768567-3768256 [Escherichia coli]
MHIISKAPFEECARKYPNDALALHSLYRVIKETDFSTPEEMRTAFPNLDNFKYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
MHIISKAPFEECARKYPNDALALHSLYRVIKETDFSTPEEMRTAFPNLDNFKYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15416.42 Da Isoelectric Point: 4.4596
>AT256107 WP_000126294.1 NZ_CP103673:c3768259-3767840 [Escherichia coli]
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLASRIAEYENNNEKFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLASRIAEYENNNEKFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|