Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yafN-yafO (relBE)/YafO-YafN
Location 1036544..1037238 Replicon chromosome
Accession NZ_CP103673
Organism Escherichia coli strain 4069

Toxin (Protein)


Gene name yafO Uniprot ID Q0T7Q5
Locus tag M4U10_RS04965 Protein ID WP_001263491.1
Coordinates 1036840..1037238 (+) Length 133 a.a.

Antitoxin (Protein)


Gene name yafN Uniprot ID L4JHF0
Locus tag M4U10_RS04960 Protein ID WP_000554755.1
Coordinates 1036544..1036837 (+) Length 98 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M4U10_RS04935 (1032165) 1032165..1032521 - 357 WP_001030484.1 type II toxin-antitoxin system HicB family antitoxin -
M4U10_RS04940 (1032514) 1032514..1032792 - 279 WP_000598760.1 type II toxin-antitoxin system HicA family toxin -
M4U10_RS04945 (1032897) 1032897..1034609 - 1713 Protein_964 flagellar biosynthesis protein FlhA -
M4U10_RS04950 (1034581) 1034581..1035366 + 786 WP_019842510.1 putative lateral flagellar export/assembly protein LafU -
M4U10_RS04955 (1035437) 1035437..1036492 + 1056 WP_001550655.1 DNA polymerase IV -
M4U10_RS04960 (1036544) 1036544..1036837 + 294 WP_000554755.1 type I toxin-antitoxin system antitoxin YafN Antitoxin
M4U10_RS04965 (1036840) 1036840..1037238 + 399 WP_001263491.1 type II toxin-antitoxin system mRNA interferase toxin YafO Toxin
M4U10_RS04970 (1037248) 1037248..1037700 + 453 WP_019842500.1 GNAT family N-acetyltransferase -
M4U10_RS04975 (1037946) 1037946..1038152 + 207 Protein_970 RtcB family protein -
M4U10_RS04980 (1038148) 1038148..1038500 + 353 Protein_971 peptide chain release factor H -
M4U10_RS04985 (1038557) 1038557..1040014 - 1458 WP_001293009.1 cytosol nonspecific dipeptidase -
M4U10_RS04990 (1040275) 1040275..1040733 + 459 WP_001291990.1 xanthine phosphoribosyltransferase -
- (1041329) 1041329..1041409 + 81 NuclAT_8 - -
- (1041329) 1041329..1041409 + 81 NuclAT_8 - -
- (1041329) 1041329..1041409 + 81 NuclAT_8 - -
- (1041329) 1041329..1041409 + 81 NuclAT_8 - -
M4U10_RS04995 (1040825) 1040825..1042069 + 1245 WP_000189541.1 esterase FrsA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase toxin YafO

(27-130)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 15457.86 Da        Isoelectric Point: 8.0949

>T256094 WP_001263491.1 NZ_CP103673:1036840-1037238 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF

Download         Length: 399 bp

Antitoxin


Download         Length: 98 a.a.        Molecular weight: 11235.78 Da        Isoelectric Point: 5.2170

>AT256094 WP_000554755.1 NZ_CP103673:1036544-1036837 [Escherichia coli]
MHRILAEKSVNITELRKNPAKYFIDQPVAVLSNNRPAGYLLSASAFEALMDMLAEQEEKKLVKARFRPSAARLEEITRRA
EQYLNDMTDDDFNDFKE

Download         Length: 294 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P7TPK7

Antitoxin

Source ID Structure
AlphaFold DB A0A829G9H5

References