Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 5176615..5177217 | Replicon | chromosome |
Accession | NZ_CP103672 | ||
Organism | Escherichia coli O25b:H4-ST131 strain 4433 |
Toxin (Protein)
Gene name | higB | Uniprot ID | S1P416 |
Locus tag | M5S92_RS25705 | Protein ID | WP_000897302.1 |
Coordinates | 5176906..5177217 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | M5S92_RS25700 | Protein ID | WP_000356397.1 |
Coordinates | 5176615..5176905 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5S92_RS25670 (5171922) | 5171922..5172851 | + | 930 | WP_000027696.1 | formate dehydrogenase accessory protein FdhE | - |
M5S92_RS25675 (5173033) | 5173033..5173275 | - | 243 | WP_001068514.1 | CopG family transcriptional regulator | - |
M5S92_RS25680 (5173565) | 5173565..5174413 | + | 849 | WP_001038650.1 | hypothetical protein | - |
M5S92_RS25685 (5174438) | 5174438..5175178 | + | 741 | WP_000608806.1 | hypothetical protein | - |
M5S92_RS25690 (5175363) | 5175363..5175581 | - | 219 | WP_001251293.1 | CopG family transcriptional regulator | - |
M5S92_RS25695 (5175978) | 5175978..5176256 | - | 279 | WP_001296612.1 | hypothetical protein | - |
M5S92_RS25700 (5176615) | 5176615..5176905 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
M5S92_RS25705 (5176906) | 5176906..5177217 | - | 312 | WP_000897302.1 | hypothetical protein | Toxin |
M5S92_RS25710 (5177446) | 5177446..5178354 | + | 909 | WP_001385591.1 | alpha/beta hydrolase | - |
M5S92_RS25715 (5178418) | 5178418..5179359 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
M5S92_RS25720 (5179404) | 5179404..5179841 | - | 438 | WP_000560981.1 | D-aminoacyl-tRNA deacylase | - |
M5S92_RS25725 (5179838) | 5179838..5180710 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
M5S92_RS25730 (5180704) | 5180704..5181303 | - | 600 | WP_001296610.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12203.19 Da Isoelectric Point: 9.7791
>T256091 WP_000897302.1 NZ_CP103672:c5177217-5176906 [Escherichia coli O25b:H4-ST131]
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|