Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
Location | 3863917..3864596 | Replicon | chromosome |
Accession | NZ_CP103672 | ||
Organism | Escherichia coli O25b:H4-ST131 strain 4433 |
Toxin (Protein)
Gene name | higB | Uniprot ID | S1PK60 |
Locus tag | M5S92_RS19480 | Protein ID | WP_000057523.1 |
Coordinates | 3864294..3864596 (-) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | S1QAY3 |
Locus tag | M5S92_RS19475 | Protein ID | WP_000806442.1 |
Coordinates | 3863917..3864258 (-) | Length | 114 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5S92_RS19465 (3860161) | 3860161..3861093 | - | 933 | WP_000883041.1 | glutaminase A | - |
M5S92_RS19470 (3861355) | 3861355..3863859 | + | 2505 | WP_000083947.1 | copper-exporting P-type ATPase CopA | - |
M5S92_RS19475 (3863917) | 3863917..3864258 | - | 342 | WP_000806442.1 | HigA family addiction module antitoxin | Antitoxin |
M5S92_RS19480 (3864294) | 3864294..3864596 | - | 303 | WP_000057523.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
M5S92_RS19485 (3864729) | 3864729..3865523 | + | 795 | WP_000365147.1 | TraB/GumN family protein | - |
M5S92_RS19490 (3865727) | 3865727..3866206 | + | 480 | WP_000186633.1 | Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK | - |
M5S92_RS19495 (3866374) | 3866374..3867030 | + | 657 | WP_015674862.1 | hypothetical protein | - |
M5S92_RS19500 (3867027) | 3867027..3867530 | + | 504 | WP_000667000.1 | hypothetical protein | - |
M5S92_RS19505 (3867568) | 3867568..3869220 | - | 1653 | WP_000771748.1 | bifunctional UDP-sugar hydrolase/5'-nucleotidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11809.44 Da Isoelectric Point: 10.3980
>T256082 WP_000057523.1 NZ_CP103672:c3864596-3864294 [Escherichia coli O25b:H4-ST131]
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
Download Length: 303 bp
Antitoxin
Download Length: 114 a.a. Molecular weight: 13171.10 Da Isoelectric Point: 5.7790
>AT256082 WP_000806442.1 NZ_CP103672:c3864258-3863917 [Escherichia coli O25b:H4-ST131]
MKQATRKPTTPGDILLYEYLEPLDLKINELAELLHVHRNSVSALINNNRKLTTEMAFRLAKVFDTTVDFWLNLQAAVDLW
EVENNMRTQEELGRIETVAEYLARREERAKKVA
MKQATRKPTTPGDILLYEYLEPLDLKINELAELLHVHRNSVSALINNNRKLTTEMAFRLAKVFDTTVDFWLNLQAAVDLW
EVENNMRTQEELGRIETVAEYLARREERAKKVA
Download Length: 342 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|