Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yefM-yoeB (relBE)/YoeB-YefM |
Location | 1992411..1992913 | Replicon | chromosome |
Accession | NZ_CP103672 | ||
Organism | Escherichia coli O25b:H4-ST131 strain 4433 |
Toxin (Protein)
Gene name | yoeB | Uniprot ID | E2QNP2 |
Locus tag | M5S92_RS09565 | Protein ID | WP_000767819.1 |
Coordinates | 1992659..1992913 (+) | Length | 85 a.a. |
Antitoxin (Protein)
Gene name | yefM | Uniprot ID | E2QNP3 |
Locus tag | M5S92_RS09560 | Protein ID | WP_001259253.1 |
Coordinates | 1992411..1992662 (+) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5S92_RS09535 (1987589) | 1987589..1988656 | - | 1068 | WP_000080057.1 | bifunctional histidinol-phosphatase/imidazoleglycerol-phosphate dehydratase HisB | - |
M5S92_RS09540 (1988656) | 1988656..1989726 | - | 1071 | WP_000108967.1 | histidinol-phosphate transaminase | - |
M5S92_RS09545 (1989723) | 1989723..1991027 | - | 1305 | WP_001296211.1 | histidinol dehydrogenase | - |
M5S92_RS09550 (1991033) | 1991033..1991932 | - | 900 | WP_000131782.1 | ATP phosphoribosyltransferase | - |
M5S92_RS09555 (1992078) | 1992078..1992128 | - | 51 | WP_001364200.1 | his operon leader peptide | - |
M5S92_RS09560 (1992411) | 1992411..1992662 | + | 252 | WP_001259253.1 | YoeB-YefM toxin-antitoxin system antitoxin YefM | Antitoxin |
M5S92_RS09565 (1992659) | 1992659..1992913 | + | 255 | WP_000767819.1 | type II toxin-antitoxin system mRNA interferase toxin YoeB | Toxin |
M5S92_RS09570 (1992996) | 1992996..1993820 | + | 825 | WP_000754737.1 | SDR family oxidoreductase | - |
M5S92_RS09575 (1993866) | 1993866..1994795 | + | 930 | WP_000803366.1 | LysR substrate-binding domain-containing protein | - |
M5S92_RS09580 (1995010) | 1995010..1995072 | + | 63 | WP_010723108.1 | membrane protein YoeI | - |
M5S92_RS09585 (1995062) | 1995062..1996420 | + | 1359 | WP_000019194.1 | putrescine/proton symporter PlaP | - |
M5S92_RS09590 (1996637) | 1996637..1997095 | + | 459 | WP_001531805.1 | IS200/IS605-like element IS200C family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 1996637..1997095 | 458 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 85 a.a. Molecular weight: 10110.53 Da Isoelectric Point: 7.2749
>T256075 WP_000767819.1 NZ_CP103672:1992659-1992913 [Escherichia coli O25b:H4-ST131]
VKLIWSEESWDDYLYWQEADKRIVKKINELIKDTRRTPFEGKGKPEPLKHNLSGFWSRRITEEHLLVYAVTDDSLLIAAC
RYHY
VKLIWSEESWDDYLYWQEADKRIVKKINELIKDTRRTPFEGKGKPEPLKHNLSGFWSRRITEEHLLVYAVTDDSLLIAAC
RYHY
Download Length: 255 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|