Detailed information of TA system TA256063

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 84676..85005
• Replicon: plasmid pMB5646_1
• Accession: NZ_CP103658
• Organism: Escherichia coli strain 3150

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: M5R25_RS25205
• Protein ID: WP_001372321.1
• Coordinates: 84676..84801 (-)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	84878..85005 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
M5R25_RS25160 (80037)	80037..80321	-	285	WP_001617873.1	type-F conjugative transfer system pilin chaperone TraQ	-
M5R25_RS25165 (80448)	80448..80768	-	321	WP_001348757.1	conjugal transfer protein TrbA	-
M5R25_RS25175 (81628)	81628..82230	+	603	WP_000243712.1	transglycosylase SLT domain-containing protein	-
M5R25_RS25180 (82527)	82527..83348	-	822	WP_001234469.1	DUF932 domain-containing protein	-
M5R25_RS25185 (83467)	83467..83754	-	288	WP_000107535.1	hypothetical protein	-
M5R25_RS25190 (83779)	83779..83985	-	207	WP_000275859.1	hypothetical protein	-
M5R25_RS25195 (84055)	84055..84228	+	174	Protein_107	hypothetical protein	-
M5R25_RS25200 (84226)	84226..84456	-	231	WP_001426396.1	hypothetical protein	-
M5R25_RS25205 (84676)	84676..84801	-	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
M5R25_RS25210 (84743)	84743..84892	-	150	Protein_110	plasmid maintenance protein Mok	-
- (84878)	84878..85005	-	128	NuclAT_0	-	Antitoxin
- (84878)	84878..85005	-	128	NuclAT_0	-	Antitoxin
- (84878)	84878..85005	-	128	NuclAT_0	-	Antitoxin
- (84878)	84878..85005	-	128	NuclAT_0	-	Antitoxin
- (86447)	86447..86549	-	103	NuclAT_1	-	-
- (86447)	86447..86549	-	103	NuclAT_1	-	-
- (86447)	86447..86549	-	103	NuclAT_1	-	-
- (86447)	86447..86549	-	103	NuclAT_1	-	-
M5R25_RS25220 (86518)	86518..87280	-	763	Protein_112	plasmid SOS inhibition protein A	-
M5R25_RS25225 (87277)	87277..87711	-	435	WP_000845940.1	conjugation system SOS inhibitor PsiB	-
M5R25_RS25230 (87766)	87766..89724	-	1959	WP_000117179.1	ParB/RepB/Spo0J family partition protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	catB3 / blaOXA-1 / aac(6')-Ib-cr / aadA5 / qacE / sul1 / mph(A) / erm(B) / tet(B) / sitABCD	iucA / iucB / iucC / iucD / iutA	1..131479	131479
	-	inside	IScluster/Tn	-	-	80816..86401	5585

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T256063 WP_001372321.1 NZ_CP103658:c84801-84676 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 128 bp

>AT256063 NZ_CP103658:c85005-84878 [Escherichia coli]
CGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGAAGATAGCCCCGTAGTAA
GTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin