Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 4881150..4881752 | Replicon | chromosome |
Accession | NZ_CP103657 | ||
Organism | Escherichia coli strain 3150 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9XIS6 |
Locus tag | M5R25_RS23600 | Protein ID | WP_000897305.1 |
Coordinates | 4881441..4881752 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | M5R25_RS23595 | Protein ID | WP_000356397.1 |
Coordinates | 4881150..4881440 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5R25_RS23575 (4877652) | 4877652..4878554 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
M5R25_RS23580 (4878551) | 4878551..4879186 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
M5R25_RS23585 (4879183) | 4879183..4880112 | + | 930 | WP_000027720.1 | formate dehydrogenase accessory protein FdhE | - |
M5R25_RS23590 (4880327) | 4880327..4880545 | - | 219 | WP_001298592.1 | CopG family transcriptional regulator | - |
M5R25_RS23595 (4881150) | 4881150..4881440 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
M5R25_RS23600 (4881441) | 4881441..4881752 | - | 312 | WP_000897305.1 | hypothetical protein | Toxin |
M5R25_RS23605 (4881981) | 4881981..4882889 | + | 909 | WP_001318161.1 | alpha/beta hydrolase | - |
M5R25_RS23610 (4882953) | 4882953..4883894 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
M5R25_RS23615 (4883939) | 4883939..4884376 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
M5R25_RS23620 (4884373) | 4884373..4885245 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
M5R25_RS23625 (4885239) | 4885239..4885838 | - | 600 | WP_001314324.1 | glucose-1-phosphatase | - |
M5R25_RS23630 (4885937) | 4885937..4886722 | - | 786 | WP_000059679.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T256061 WP_000897305.1 NZ_CP103657:c4881752-4881441 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|