Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
Location | 3976273..3976967 | Replicon | chromosome |
Accession | NZ_CP103657 | ||
Organism | Escherichia coli strain 3150 |
Toxin (Protein)
Gene name | yafO | Uniprot ID | Q0T7Q5 |
Locus tag | M5R25_RS19185 | Protein ID | WP_001263491.1 |
Coordinates | 3976273..3976671 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | yafN | Uniprot ID | L4JHF0 |
Locus tag | M5R25_RS19190 | Protein ID | WP_000554755.1 |
Coordinates | 3976674..3976967 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5R25_RS19155 (3971535) | 3971535..3972992 | + | 1458 | WP_022645227.1 | cytosol nonspecific dipeptidase | - |
M5R25_RS19160 (3973001) | 3973001..3973282 | + | 282 | WP_022645226.1 | hypothetical protein | - |
M5R25_RS19165 (3973299) | 3973299..3973808 | - | 510 | WP_001361775.1 | metal-dependent hydrolase | - |
M5R25_RS19170 (3973870) | 3973870..3974484 | - | 615 | WP_022645225.1 | peptide chain release factor H | - |
M5R25_RS19175 (3974481) | 3974481..3975620 | - | 1140 | WP_022645224.1 | RNA ligase RtcB family protein | - |
M5R25_RS19180 (3975811) | 3975811..3976263 | - | 453 | WP_023909048.1 | GNAT family N-acetyltransferase | - |
M5R25_RS19185 (3976273) | 3976273..3976671 | - | 399 | WP_001263491.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
M5R25_RS19190 (3976674) | 3976674..3976967 | - | 294 | WP_000554755.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
M5R25_RS19195 (3977019) | 3977019..3978074 | - | 1056 | WP_022645222.1 | DNA polymerase IV | - |
M5R25_RS19200 (3978145) | 3978145..3978930 | - | 786 | WP_072224360.1 | putative lateral flagellar export/assembly protein LafU | - |
M5R25_RS19205 (3978902) | 3978902..3980614 | + | 1713 | Protein_3765 | flagellar biosynthesis protein FlhA | - |
M5R25_RS19210 (3980712) | 3980712..3981485 | - | 774 | WP_022645219.1 | C40 family peptidase | - |
M5R25_RS19215 (3981671) | 3981671..3981931 | + | 261 | WP_000729708.1 | type II toxin-antitoxin system antitoxin DinJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15457.86 Da Isoelectric Point: 8.0949
>T256055 WP_001263491.1 NZ_CP103657:c3976671-3976273 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4P7TPK7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829G9H5 |