Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 652066..652865 | Replicon | chromosome |
Accession | NZ_CP103657 | ||
Organism | Escherichia coli strain 3150 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | V0SSH7 |
Locus tag | M5R25_RS03085 | Protein ID | WP_000347273.1 |
Coordinates | 652066..652530 (-) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | D6JF08 |
Locus tag | M5R25_RS03090 | Protein ID | WP_001308975.1 |
Coordinates | 652530..652865 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5R25_RS03055 (647067) | 647067..647501 | - | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
M5R25_RS03060 (647519) | 647519..648397 | - | 879 | WP_001298314.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
M5R25_RS03065 (648387) | 648387..649166 | - | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
M5R25_RS03070 (649177) | 649177..649650 | - | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
M5R25_RS03075 (649673) | 649673..650953 | - | 1281 | WP_023908831.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
M5R25_RS03080 (651202) | 651202..652011 | + | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
M5R25_RS03085 (652066) | 652066..652530 | - | 465 | WP_000347273.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
M5R25_RS03090 (652530) | 652530..652865 | - | 336 | WP_001308975.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
M5R25_RS03095 (653014) | 653014..654585 | - | 1572 | WP_023908830.1 | galactarate dehydratase | - |
M5R25_RS03100 (654960) | 654960..656294 | + | 1335 | WP_000599651.1 | galactarate/glucarate/glycerate transporter GarP | - |
M5R25_RS03105 (656310) | 656310..657080 | + | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17836.25 Da Isoelectric Point: 9.6924
>T256041 WP_000347273.1 NZ_CP103657:c652530-652066 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|