Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/RelE-HTH |
Location | 2460053..2460742 | Replicon | chromosome |
Accession | NZ_CP103654 | ||
Organism | Klebsiella pneumoniae strain 1159 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A331C6E2 |
Locus tag | M5S75_RS12160 | Protein ID | WP_021469727.1 |
Coordinates | 2460053..2460370 (+) | Length | 106 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A6B0N7G3 |
Locus tag | M5S75_RS12165 | Protein ID | WP_020804705.1 |
Coordinates | 2460446..2460742 (+) | Length | 99 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5S75_RS12130 (2455755) | 2455755..2456264 | + | 510 | WP_020802144.1 | GNAT family N-acetyltransferase | - |
M5S75_RS12135 (2456274) | 2456274..2457200 | + | 927 | WP_032435210.1 | amino acid ABC transporter permease | - |
M5S75_RS12140 (2457184) | 2457184..2457963 | + | 780 | WP_002906697.1 | amino acid ABC transporter ATP-binding protein | - |
M5S75_RS12145 (2458002) | 2458002..2458853 | + | 852 | WP_072198177.1 | transporter substrate-binding domain-containing protein | - |
M5S75_RS12150 (2458931) | 2458931..2459548 | + | 618 | WP_032425015.1 | glutathione S-transferase family protein | - |
M5S75_RS12155 (2459619) | 2459619..2459846 | + | 228 | WP_002906690.1 | tautomerase PptA | - |
M5S75_RS12160 (2460053) | 2460053..2460370 | + | 318 | WP_021469727.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
M5S75_RS12165 (2460446) | 2460446..2460742 | + | 297 | WP_020804705.1 | NadS family protein | Antitoxin |
M5S75_RS12170 (2460821) | 2460821..2461267 | + | 447 | WP_032435212.1 | hypothetical protein | - |
M5S75_RS12175 (2461308) | 2461308..2462924 | - | 1617 | WP_004175961.1 | carbohydrate porin | - |
M5S75_RS12180 (2462968) | 2462968..2464350 | - | 1383 | WP_004151222.1 | MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12221.10 Da Isoelectric Point: 10.2217
>T256031 WP_021469727.1 NZ_CP103654:2460053-2460370 [Klebsiella pneumoniae]
MLTFIELQGFSKRRQVLLQDDEFRAFQEILINDPEAGDTISGTGGFRKIRWSRPGMGKRGGVRVIYYNVTKKGRIYLALI
YPKNEQDELNQEQKKMLRQVADLIN
MLTFIELQGFSKRRQVLLQDDEFRAFQEILINDPEAGDTISGTGGFRKIRWSRPGMGKRGGVRVIYYNVTKKGRIYLALI
YPKNEQDELNQEQKKMLRQVADLIN
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A331C6E2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6B0N7G3 |