Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 351841..352487 | Replicon | chromosome |
Accession | NZ_CP103654 | ||
Organism | Klebsiella pneumoniae strain 1159 |
Toxin (Protein)
Gene name | higB | Uniprot ID | W9BBY1 |
Locus tag | M5S75_RS01625 | Protein ID | WP_016529833.1 |
Coordinates | 351841..352188 (+) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | W8UB68 |
Locus tag | M5S75_RS01630 | Protein ID | WP_002920557.1 |
Coordinates | 352188..352487 (+) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5S75_RS01615 (347777) | 347777..349210 | + | 1434 | WP_002920564.1 | glycogen synthase GlgA | - |
M5S75_RS01620 (349228) | 349228..351675 | + | 2448 | WP_002920561.1 | glycogen phosphorylase | - |
M5S75_RS01625 (351841) | 351841..352188 | + | 348 | WP_016529833.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
M5S75_RS01630 (352188) | 352188..352487 | + | 300 | WP_002920557.1 | helix-turn-helix transcriptional regulator | Antitoxin |
M5S75_RS01635 (352550) | 352550..354058 | - | 1509 | WP_259418820.1 | glycerol-3-phosphate dehydrogenase | - |
M5S75_RS01640 (354263) | 354263..354592 | + | 330 | WP_002920552.1 | thiosulfate sulfurtransferase GlpE | - |
M5S75_RS01645 (354643) | 354643..355473 | + | 831 | WP_004151408.1 | rhomboid family intramembrane serine protease GlpG | - |
M5S75_RS01650 (355523) | 355523..356281 | + | 759 | WP_002920548.1 | DeoR/GlpR family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 13549.56 Da Isoelectric Point: 5.6749
>T256025 WP_016529833.1 NZ_CP103654:351841-352188 [Klebsiella pneumoniae]
MWDVETTDTFDTWFELQSRALKEDMLATMLILSEFAPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRAFFAFDPLRKAI
VLCAGDKDGMNEKRFYKEMITLADREFSQHLTKER
MWDVETTDTFDTWFELQSRALKEDMLATMLILSEFAPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRAFFAFDPLRKAI
VLCAGDKDGMNEKRFYKEMITLADREFSQHLTKER
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | W9BBY1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E1CBF8 |