Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 59966..60220 | Replicon | plasmid pMB5823_1 |
| Accession | NZ_CP103646 | ||
| Organism | Escherichia coli strain 961 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | M5R18_RS24205 | Protein ID | WP_001312851.1 |
| Coordinates | 60071..60220 (+) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 59966..60027 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5R18_RS24170 (55618) | 55618..55830 | + | 213 | WP_005012601.1 | hypothetical protein | - |
| M5R18_RS24175 (56131) | 56131..56220 | - | 90 | Protein_71 | IS1 family transposase | - |
| M5R18_RS24180 (56275) | 56275..56952 | + | 678 | WP_001339397.1 | IS66-like element accessory protein TnpA | - |
| M5R18_RS24185 (56952) | 56952..57299 | + | 348 | WP_000624622.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| M5R18_RS24190 (57319) | 57319..58890 | + | 1572 | WP_106490499.1 | IS66 family transposase | - |
| M5R18_RS24195 (58928) | 58928..59544 | - | 617 | Protein_75 | IS1-like element IS1A family transposase | - |
| M5R18_RS24200 (59645) | 59645..59827 | + | 183 | WP_000968309.1 | hypothetical protein | - |
| - (59966) | 59966..60027 | - | 62 | NuclAT_2 | - | Antitoxin |
| - (59966) | 59966..60027 | - | 62 | NuclAT_2 | - | Antitoxin |
| - (59966) | 59966..60027 | - | 62 | NuclAT_2 | - | Antitoxin |
| - (59966) | 59966..60027 | - | 62 | NuclAT_2 | - | Antitoxin |
| M5R18_RS24205 (60071) | 60071..60220 | + | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| M5R18_RS24210 (60504) | 60504..60761 | + | 258 | WP_000083833.1 | replication regulatory protein RepA | - |
| M5R18_RS24215 (60997) | 60997..61071 | + | 75 | WP_032336874.1 | RepA leader peptide Tap | - |
| M5R18_RS24220 (61064) | 61064..61510 | + | 447 | Protein_80 | plasmid replication initiator RepA | - |
| M5R18_RS24225 (61510) | 61510..62124 | - | 615 | Protein_81 | VENN motif pre-toxin domain-containing protein | - |
| M5R18_RS24230 (62831) | 62831..64051 | + | 1221 | WP_000410951.1 | arginine deiminase | - |
| M5R18_RS24235 (64062) | 64062..64973 | + | 912 | WP_000440183.1 | carbamate kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | dfrA12 / aadA2 / qacE / sul1 / blaNDM-5 / sitABCD | iucA / iucB / iucC / iucD / iutA | 1..187551 | 187551 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T256018 WP_001312851.1 NZ_CP103646:60071-60220 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 62 bp
>AT256018 NZ_CP103646:c60027-59966 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
