Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 19920..20153 | Replicon | plasmid pMB5823_1 |
| Accession | NZ_CP103646 | ||
| Organism | Escherichia coli strain 961 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | G9G195 |
| Locus tag | M5R18_RS23960 | Protein ID | WP_001323520.1 |
| Coordinates | 20037..20153 (+) | Length | 39 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 19920..19951 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5R18_RS23920 (16041) | 16041..16538 | + | 498 | WP_042039995.1 | single-stranded DNA-binding protein | - |
| M5R18_RS23925 (16606) | 16606..16839 | + | 234 | WP_000005990.1 | DUF905 family protein | - |
| M5R18_RS23930 (16867) | 16867..17064 | + | 198 | Protein_22 | hypothetical protein | - |
| M5R18_RS23935 (17119) | 17119..17553 | + | 435 | WP_000845937.1 | conjugation system SOS inhibitor PsiB | - |
| M5R18_RS23940 (17550) | 17550..18312 | + | 763 | Protein_24 | plasmid SOS inhibition protein A | - |
| M5R18_RS23945 (18281) | 18281..18469 | - | 189 | WP_001299721.1 | hypothetical protein | - |
| - (18281) | 18281..18478 | + | 198 | NuclAT_0 | - | - |
| - (18281) | 18281..18478 | + | 198 | NuclAT_0 | - | - |
| - (18281) | 18281..18478 | + | 198 | NuclAT_0 | - | - |
| - (18281) | 18281..18478 | + | 198 | NuclAT_0 | - | - |
| M5R18_RS23950 (18526) | 18526..19895 | + | 1370 | WP_085947770.1 | IS3-like element IS150 family transposase | - |
| - (19920) | 19920..19951 | + | 32 | NuclAT_1 | - | Antitoxin |
| - (19920) | 19920..19951 | + | 32 | NuclAT_1 | - | Antitoxin |
| - (19920) | 19920..19951 | + | 32 | NuclAT_1 | - | Antitoxin |
| - (19920) | 19920..19951 | + | 32 | NuclAT_1 | - | Antitoxin |
| M5R18_RS23955 (19937) | 19937..20086 | + | 150 | Protein_27 | plasmid maintenance protein Mok | - |
| M5R18_RS23960 (20037) | 20037..20153 | + | 117 | WP_001323520.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| M5R18_RS23965 (20373) | 20373..20603 | + | 231 | WP_071886920.1 | hypothetical protein | - |
| M5R18_RS23970 (20601) | 20601..20773 | - | 173 | Protein_30 | hypothetical protein | - |
| M5R18_RS23975 (20843) | 20843..21049 | + | 207 | WP_000547968.1 | hypothetical protein | - |
| M5R18_RS23980 (21074) | 21074..21361 | + | 288 | WP_000107535.1 | hypothetical protein | - |
| M5R18_RS23985 (21479) | 21479..22300 | + | 822 | WP_001234426.1 | DUF932 domain-containing protein | - |
| M5R18_RS23990 (22597) | 22597..23199 | - | 603 | WP_013362798.1 | transglycosylase SLT domain-containing protein | - |
| M5R18_RS23995 (23520) | 23520..23903 | + | 384 | WP_001151524.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| M5R18_RS24000 (24090) | 24090..24779 | + | 690 | WP_000283385.1 | conjugal transfer transcriptional regulator TraJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | dfrA12 / aadA2 / qacE / sul1 / blaNDM-5 / sitABCD | iucA / iucB / iucC / iucD / iutA | 1..187551 | 187551 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 39 a.a. Molecular weight: 4455.23 Da Isoelectric Point: 8.5110
>T256015 WP_001323520.1 NZ_CP103646:20037-20153 [Escherichia coli]
VCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 117 bp
Antitoxin
Download Length: 32 bp
>AT256015 NZ_CP103646:19920-19951 [Escherichia coli]
CACCACGAGGCATCCCTATGTCTAGTCCACAT
CACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|