Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 19920..20153 Replicon plasmid pMB5823_1
Accession NZ_CP103646
Organism Escherichia coli strain 961

Toxin (Protein)


Gene name hok Uniprot ID G9G195
Locus tag M5R18_RS23960 Protein ID WP_001323520.1
Coordinates 20037..20153 (+) Length 39 a.a.

Antitoxin (RNA)


Gene name sok
Locus tag -
Coordinates 19920..19951 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5R18_RS23920 (16041) 16041..16538 + 498 WP_042039995.1 single-stranded DNA-binding protein -
M5R18_RS23925 (16606) 16606..16839 + 234 WP_000005990.1 DUF905 family protein -
M5R18_RS23930 (16867) 16867..17064 + 198 Protein_22 hypothetical protein -
M5R18_RS23935 (17119) 17119..17553 + 435 WP_000845937.1 conjugation system SOS inhibitor PsiB -
M5R18_RS23940 (17550) 17550..18312 + 763 Protein_24 plasmid SOS inhibition protein A -
M5R18_RS23945 (18281) 18281..18469 - 189 WP_001299721.1 hypothetical protein -
- (18281) 18281..18478 + 198 NuclAT_0 - -
- (18281) 18281..18478 + 198 NuclAT_0 - -
- (18281) 18281..18478 + 198 NuclAT_0 - -
- (18281) 18281..18478 + 198 NuclAT_0 - -
M5R18_RS23950 (18526) 18526..19895 + 1370 WP_085947770.1 IS3-like element IS150 family transposase -
- (19920) 19920..19951 + 32 NuclAT_1 - Antitoxin
- (19920) 19920..19951 + 32 NuclAT_1 - Antitoxin
- (19920) 19920..19951 + 32 NuclAT_1 - Antitoxin
- (19920) 19920..19951 + 32 NuclAT_1 - Antitoxin
M5R18_RS23955 (19937) 19937..20086 + 150 Protein_27 plasmid maintenance protein Mok -
M5R18_RS23960 (20037) 20037..20153 + 117 WP_001323520.1 type I toxin-antitoxin system Hok family toxin Toxin
M5R18_RS23965 (20373) 20373..20603 + 231 WP_071886920.1 hypothetical protein -
M5R18_RS23970 (20601) 20601..20773 - 173 Protein_30 hypothetical protein -
M5R18_RS23975 (20843) 20843..21049 + 207 WP_000547968.1 hypothetical protein -
M5R18_RS23980 (21074) 21074..21361 + 288 WP_000107535.1 hypothetical protein -
M5R18_RS23985 (21479) 21479..22300 + 822 WP_001234426.1 DUF932 domain-containing protein -
M5R18_RS23990 (22597) 22597..23199 - 603 WP_013362798.1 transglycosylase SLT domain-containing protein -
M5R18_RS23995 (23520) 23520..23903 + 384 WP_001151524.1 conjugal transfer relaxosome DNA-binding protein TraM -
M5R18_RS24000 (24090) 24090..24779 + 690 WP_000283385.1 conjugal transfer transcriptional regulator TraJ -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid dfrA12 / aadA2 / qacE / sul1 / blaNDM-5 / sitABCD iucA / iucB / iucC / iucD / iutA 1..187551 187551


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(1-34)


Sequences

Toxin        


Download         Length: 39 a.a.        Molecular weight: 4455.23 Da        Isoelectric Point: 8.5110

>T256015 WP_001323520.1 NZ_CP103646:20037-20153 [Escherichia coli]
VCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Download         Length: 117 bp

Antitoxin


Download         Length: 32 bp

>AT256015 NZ_CP103646:19920-19951 [Escherichia coli]
CACCACGAGGCATCCCTATGTCTAGTCCACAT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G9G195

Antitoxin

Download structure file

References