Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 4990700..4991302 | Replicon | chromosome |
Accession | NZ_CP103633 | ||
Organism | Escherichia coli strain 2900 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9XIS6 |
Locus tag | M5S90_RS24000 | Protein ID | WP_000897305.1 |
Coordinates | 4990991..4991302 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | M5S90_RS23995 | Protein ID | WP_000356395.1 |
Coordinates | 4990700..4990990 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5S90_RS23960 (4986323) | 4986323..4987225 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
M5S90_RS23965 (4987222) | 4987222..4987857 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
M5S90_RS23970 (4987854) | 4987854..4988783 | + | 930 | WP_000027708.1 | formate dehydrogenase accessory protein FdhE | - |
M5S90_RS23975 (4988965) | 4988965..4989207 | - | 243 | WP_021523315.1 | hypothetical protein | - |
M5S90_RS23980 (4989426) | 4989426..4989644 | - | 219 | WP_001295676.1 | CopG family transcriptional regulator | - |
M5S90_RS23985 (4990063) | 4990063..4990341 | - | 279 | WP_001306650.1 | hypothetical protein | - |
M5S90_RS23990 (4990403) | 4990403..4990615 | - | 213 | WP_000197769.1 | hypothetical protein | - |
M5S90_RS23995 (4990700) | 4990700..4990990 | - | 291 | WP_000356395.1 | NadS family protein | Antitoxin |
M5S90_RS24000 (4990991) | 4990991..4991302 | - | 312 | WP_000897305.1 | hypothetical protein | Toxin |
M5S90_RS24005 (4991531) | 4991531..4992439 | + | 909 | WP_001306651.1 | alpha/beta hydrolase | - |
M5S90_RS24010 (4992608) | 4992608..4993522 | - | 915 | WP_077634137.1 | transposase | - |
M5S90_RS24015 (4993535) | 4993535..4994422 | - | 888 | Protein_4694 | hypothetical protein | - |
M5S90_RS24020 (4994838) | 4994838..4995779 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
M5S90_RS24025 (4995824) | 4995824..4996261 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T255947 WP_000897305.1 NZ_CP103633:c4991302-4990991 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|