Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yafN-yafO (relBE)/YafO-YafN
Location 4026637..4027331 Replicon chromosome
Accession NZ_CP103633
Organism Escherichia coli strain 2900

Toxin (Protein)


Gene name yafO Uniprot ID A0A0D8WHS4
Locus tag M5S90_RS19385 Protein ID WP_001521903.1
Coordinates 4026637..4027035 (-) Length 133 a.a.

Antitoxin (Protein)


Gene name yafN Uniprot ID S1QAE3
Locus tag M5S90_RS19390 Protein ID WP_000554758.1
Coordinates 4027038..4027331 (-) Length 98 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
- (4022467) 4022467..4022547 - 81 NuclAT_11 - -
- (4022467) 4022467..4022547 - 81 NuclAT_11 - -
- (4022467) 4022467..4022547 - 81 NuclAT_11 - -
- (4022467) 4022467..4022547 - 81 NuclAT_11 - -
M5S90_RS19355 (4021807) 4021807..4023051 - 1245 WP_000189541.1 esterase FrsA -
M5S90_RS19360 (4023143) 4023143..4023601 - 459 WP_001291990.1 xanthine phosphoribosyltransferase -
M5S90_RS19365 (4023862) 4023862..4025319 + 1458 WP_001293009.1 cytosol nonspecific dipeptidase -
M5S90_RS19370 (4025376) 4025376..4025728 - 353 Protein_3792 peptide chain release factor H -
M5S90_RS19375 (4025724) 4025724..4025930 - 207 Protein_3793 RtcB family protein -
M5S90_RS19380 (4026175) 4026175..4026627 - 453 WP_023144376.1 GNAT family N-acetyltransferase -
M5S90_RS19385 (4026637) 4026637..4027035 - 399 WP_001521903.1 type II toxin-antitoxin system mRNA interferase toxin YafO Toxin
M5S90_RS19390 (4027038) 4027038..4027331 - 294 WP_000554758.1 type I toxin-antitoxin system antitoxin YafN Antitoxin
M5S90_RS19395 (4027383) 4027383..4028438 - 1056 WP_001226177.1 DNA polymerase IV -
M5S90_RS19400 (4028509) 4028509..4029294 - 786 WP_000207556.1 putative lateral flagellar export/assembly protein LafU -
M5S90_RS19405 (4029266) 4029266..4030978 + 1713 Protein_3799 flagellar biosynthesis protein FlhA -
M5S90_RS19410 (4031057) 4031057..4031410 + 354 WP_024166466.1 type II toxin-antitoxin system HicB family antitoxin -
M5S90_RS19415 (4031467) 4031467..4032216 - 750 WP_016233951.1 C40 family peptidase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 4015797..4027331 11534


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase toxin YafO

(27-130)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 15471.88 Da        Isoelectric Point: 8.0949

>T255941 WP_001521903.1 NZ_CP103633:c4027035-4026637 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGILPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF

Download         Length: 399 bp

Antitoxin


Download         Length: 98 a.a.        Molecular weight: 11233.76 Da        Isoelectric Point: 5.2170

>AT255941 WP_000554758.1 NZ_CP103633:c4027331-4027038 [Escherichia coli]
MHRILAEKSVNITELRKNPAKYFIDQPVAVLSNNRPAGYLLSASAFEALMDMLAEQEEKKPIKARFRPSAARLEEITRRA
EQYLNDMTDDDFNDFKE

Download         Length: 294 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0D8WHS4

Antitoxin

Source ID Structure
AlphaFold DB S1QAE3

References