Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 48968..49232 | Replicon | plasmid pMB6206_2 |
| Accession | NZ_CP103628 | ||
| Organism | Escherichia coli strain 4012 | ||
Toxin (Protein)
| Gene name | pndA | Uniprot ID | U9Y6M3 |
| Locus tag | M5S78_RS24575 | Protein ID | WP_001331364.1 |
| Coordinates | 48968..49120 (-) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | pndB | ||
| Locus tag | - | ||
| Coordinates | 49175..49232 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5S78_RS24545 (44245) | 44245..46413 | + | 2169 | WP_033561886.1 | DotA/TraY family protein | - |
| M5S78_RS24550 (46487) | 46487..47137 | + | 651 | WP_032179289.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
| M5S78_RS24555 (47209) | 47209..47418 | - | 210 | WP_000062603.1 | HEAT repeat domain-containing protein | - |
| M5S78_RS24560 (47810) | 47810..47986 | + | 177 | WP_001054897.1 | hypothetical protein | - |
| M5S78_RS24565 (48051) | 48051..48283 | - | 233 | Protein_48 | hypothetical protein | - |
| M5S78_RS24570 (48645) | 48645..48896 | + | 252 | WP_001291964.1 | hypothetical protein | - |
| M5S78_RS24575 (48968) | 48968..49120 | - | 153 | WP_001331364.1 | Hok/Gef family protein | Toxin |
| - (49175) | 49175..49232 | + | 58 | NuclAT_0 | - | Antitoxin |
| - (49175) | 49175..49232 | + | 58 | NuclAT_0 | - | Antitoxin |
| - (49175) | 49175..49232 | + | 58 | NuclAT_0 | - | Antitoxin |
| - (49175) | 49175..49232 | + | 58 | NuclAT_0 | - | Antitoxin |
| M5S78_RS24580 (49412) | 49412..50620 | + | 1209 | WP_000121273.1 | IncI1-type conjugal transfer protein TrbA | - |
| M5S78_RS24585 (50639) | 50639..51709 | + | 1071 | WP_000151583.1 | IncI1-type conjugal transfer protein TrbB | - |
| M5S78_RS24590 (51702) | 51702..53993 | + | 2292 | WP_001289276.1 | F-type conjugative transfer protein TrbC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..86843 | 86843 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5775.13 Da Isoelectric Point: 8.7948
>T255918 WP_001331364.1 NZ_CP103628:c49120-48968 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
Antitoxin
Download Length: 58 bp
>AT255918 NZ_CP103628:49175-49232 [Escherichia coli]
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|