Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 48968..49232 Replicon plasmid pMB6206_2
Accession NZ_CP103628
Organism Escherichia coli strain 4012

Toxin (Protein)


Gene name pndA Uniprot ID U9Y6M3
Locus tag M5S78_RS24575 Protein ID WP_001331364.1
Coordinates 48968..49120 (-) Length 51 a.a.

Antitoxin (RNA)


Gene name pndB
Locus tag -
Coordinates 49175..49232 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5S78_RS24545 (44245) 44245..46413 + 2169 WP_033561886.1 DotA/TraY family protein -
M5S78_RS24550 (46487) 46487..47137 + 651 WP_032179289.1 plasmid IncI1-type surface exclusion protein ExcA -
M5S78_RS24555 (47209) 47209..47418 - 210 WP_000062603.1 HEAT repeat domain-containing protein -
M5S78_RS24560 (47810) 47810..47986 + 177 WP_001054897.1 hypothetical protein -
M5S78_RS24565 (48051) 48051..48283 - 233 Protein_48 hypothetical protein -
M5S78_RS24570 (48645) 48645..48896 + 252 WP_001291964.1 hypothetical protein -
M5S78_RS24575 (48968) 48968..49120 - 153 WP_001331364.1 Hok/Gef family protein Toxin
- (49175) 49175..49232 + 58 NuclAT_0 - Antitoxin
- (49175) 49175..49232 + 58 NuclAT_0 - Antitoxin
- (49175) 49175..49232 + 58 NuclAT_0 - Antitoxin
- (49175) 49175..49232 + 58 NuclAT_0 - Antitoxin
M5S78_RS24580 (49412) 49412..50620 + 1209 WP_000121273.1 IncI1-type conjugal transfer protein TrbA -
M5S78_RS24585 (50639) 50639..51709 + 1071 WP_000151583.1 IncI1-type conjugal transfer protein TrbB -
M5S78_RS24590 (51702) 51702..53993 + 2292 WP_001289276.1 F-type conjugative transfer protein TrbC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - - 1..86843 86843


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(7-46)


Sequences

Toxin        


Download         Length: 51 a.a.        Molecular weight: 5775.13 Da        Isoelectric Point: 8.7948

>T255918 WP_001331364.1 NZ_CP103628:c49120-48968 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR

Download         Length: 153 bp

Antitoxin


Download         Length: 58 bp

>AT255918 NZ_CP103628:49175-49232 [Escherichia coli]
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5W9M382

Antitoxin

Download structure file

References