Detailed information of TA system TA255915

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 114705..115131
• Replicon: plasmid pMB6206_1
• Accession: NZ_CP103627
• Organism: Escherichia coli strain 4012

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: M5S78_RS24170
• Protein ID: WP_001372321.1
• Coordinates: 114705..114830 (-)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	114907..115131 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
M5S78_RS24130 (110077)	110077..110766	-	690	WP_000283385.1	conjugal transfer transcriptional regulator TraJ	-
M5S78_RS24135 (110953)	110953..111336	-	384	WP_001151524.1	conjugal transfer relaxosome DNA-binding protein TraM	-
M5S78_RS24140 (111657)	111657..112259	+	603	WP_072156291.1	transglycosylase SLT domain-containing protein	-
M5S78_RS24145 (112556)	112556..113377	-	822	WP_001234469.1	DUF932 domain-containing protein	-
M5S78_RS24150 (113496)	113496..113783	-	288	WP_000107535.1	hypothetical protein	-
M5S78_RS24155 (113808)	113808..114014	-	207	WP_000547971.1	hypothetical protein	-
M5S78_RS24160 (114084)	114084..114257	+	174	Protein_135	hypothetical protein	-
M5S78_RS24165 (114255)	114255..114485	-	231	WP_001426396.1	hypothetical protein	-
M5S78_RS24170 (114705)	114705..114830	-	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
M5S78_RS24175 (114772)	114772..114921	-	150	Protein_138	plasmid maintenance protein Mok	-
- (114907)	114907..115131	-	225	NuclAT_0	-	Antitoxin
- (114907)	114907..115131	-	225	NuclAT_0	-	Antitoxin
- (114907)	114907..115131	-	225	NuclAT_0	-	Antitoxin
- (114907)	114907..115131	-	225	NuclAT_0	-	Antitoxin
M5S78_RS24180 (114943)	114943..115131	+	189	WP_001299721.1	hypothetical protein	-
M5S78_RS24185 (115100)	115100..115862	-	763	Protein_140	plasmid SOS inhibition protein A	-
M5S78_RS24190 (115859)	115859..116293	-	435	WP_064770609.1	conjugation system SOS inhibitor PsiB	-
M5S78_RS24195 (116348)	116348..116545	-	198	Protein_142	hypothetical protein	-
M5S78_RS24200 (116573)	116573..116806	-	234	WP_000005987.1	DUF905 family protein	-
M5S78_RS24205 (116874)	116874..117413	-	540	WP_000290840.1	single-stranded DNA-binding protein	-
M5S78_RS24210 (117439)	117439..117645	-	207	WP_000275856.1	hypothetical protein	-
M5S78_RS24215 (117715)	117715..117795	+	81	Protein_146	hypothetical protein	-
M5S78_RS24220 (117978)	117978..118147	-	170	Protein_147	hypothetical protein	-
M5S78_RS24225 (118784)	118784..119755	-	972	WP_000817028.1	ParB/RepB/Spo0J family plasmid partition protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	blaCTX-M-55 / tet(A) / aph(3')-Ia / dfrA14 / sul3 / ant(3'')-Ia / floR / aac(3)-IIa / sitABCD	iutA / iucD / iucC / iucB / iucA	1..140136	140136

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T255915 WP_001372321.1 NZ_CP103627:c114830-114705 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT255915 NZ_CP103627:c115131-114907 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAAGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin