Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 73834..74088 | Replicon | plasmid pMB6206_1 |
Accession | NZ_CP103627 | ||
Organism | Escherichia coli strain 4012 |
Toxin (Protein)
Gene name | srnB | Uniprot ID | G9G1E3 |
Locus tag | M5S78_RS23915 | Protein ID | WP_001312851.1 |
Coordinates | 73834..73983 (-) | Length | 50 a.a. |
Antitoxin (RNA)
Gene name | srnC | ||
Locus tag | - | ||
Coordinates | 74027..74088 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5S78_RS23875 (69120) | 69120..69545 | + | 426 | WP_000422741.1 | transposase | - |
M5S78_RS23880 (69542) | 69542..69892 | + | 351 | WP_000624722.1 | IS66 family insertion sequence element accessory protein TnpB | - |
M5S78_RS23885 (69923) | 69923..71536 | + | 1614 | WP_001366169.1 | IS66-like element ISEc23 family transposase | - |
M5S78_RS23890 (71662) | 71662..72519 | - | 858 | WP_000774297.1 | incFII family plasmid replication initiator RepA | - |
M5S78_RS23895 (72512) | 72512..72994 | - | 483 | WP_001273588.1 | hypothetical protein | - |
M5S78_RS23900 (72987) | 72987..73034 | - | 48 | WP_229471593.1 | hypothetical protein | - |
M5S78_RS23905 (73025) | 73025..73276 | + | 252 | WP_223195197.1 | replication protein RepA | - |
M5S78_RS23910 (73293) | 73293..73550 | - | 258 | WP_000083845.1 | replication regulatory protein RepA | - |
M5S78_RS23915 (73834) | 73834..73983 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
- (74027) | 74027..74088 | + | 62 | NuclAT_1 | - | Antitoxin |
- (74027) | 74027..74088 | + | 62 | NuclAT_1 | - | Antitoxin |
- (74027) | 74027..74088 | + | 62 | NuclAT_1 | - | Antitoxin |
- (74027) | 74027..74088 | + | 62 | NuclAT_1 | - | Antitoxin |
M5S78_RS23920 (74344) | 74344..74418 | - | 75 | Protein_87 | endonuclease | - |
M5S78_RS23925 (74664) | 74664..74876 | - | 213 | WP_001299730.1 | ANR family transcriptional regulator | - |
M5S78_RS23930 (75012) | 75012..75572 | - | 561 | WP_000139315.1 | fertility inhibition protein FinO | - |
M5S78_RS23935 (75675) | 75675..76535 | - | 861 | WP_000704513.1 | alpha/beta hydrolase | - |
M5S78_RS23940 (76594) | 76594..77340 | - | 747 | WP_000205749.1 | conjugal transfer pilus acetylase TraX | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | blaCTX-M-55 / tet(A) / aph(3')-Ia / dfrA14 / sul3 / ant(3'')-Ia / floR / aac(3)-IIa / sitABCD | iutA / iucD / iucC / iucB / iucA | 1..140136 | 140136 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T255910 WP_001312851.1 NZ_CP103627:c73983-73834 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 62 bp
>AT255910 NZ_CP103627:74027-74088 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|