Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 1091956..1092683 | Replicon | chromosome |
Accession | NZ_CP103626 | ||
Organism | Escherichia coli strain 4012 |
Toxin (Protein)
Gene name | higB | Uniprot ID | J7Q991 |
Locus tag | M5S78_RS05285 | Protein ID | WP_000547564.1 |
Coordinates | 1091956..1092267 (+) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | M5S78_RS05290 | Protein ID | WP_000126294.1 |
Coordinates | 1092264..1092683 (+) | Length | 140 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5S78_RS05255 (1087098) | 1087098..1088807 | + | 1710 | WP_001288134.1 | formate hydrogenlyase subunit HycE | - |
M5S78_RS05260 (1088817) | 1088817..1089359 | + | 543 | WP_000493792.1 | formate hydrogenlyase subunit HycF | - |
M5S78_RS05265 (1089359) | 1089359..1090126 | + | 768 | WP_000067399.1 | formate hydrogenlyase subunit HycG | - |
M5S78_RS05270 (1090123) | 1090123..1090533 | + | 411 | WP_001291921.1 | formate hydrogenlyase assembly protein HycH | - |
M5S78_RS05275 (1090526) | 1090526..1090996 | + | 471 | WP_000132961.1 | hydrogenase maturation peptidase HycI | - |
M5S78_RS05280 (1091021) | 1091021..1091782 | + | 762 | WP_001026446.1 | hypothetical protein | - |
M5S78_RS05285 (1091956) | 1091956..1092267 | + | 312 | WP_000547564.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
M5S78_RS05290 (1092264) | 1092264..1092683 | + | 420 | WP_000126294.1 | helix-turn-helix domain-containing protein | Antitoxin |
M5S78_RS05295 (1092797) | 1092797..1094221 | - | 1425 | WP_000110313.1 | 6-phospho-beta-glucosidase AscB | - |
M5S78_RS05300 (1094230) | 1094230..1095687 | - | 1458 | WP_001107856.1 | PTS cellobiose/arbutin/salicin transporter subunit IIBC | - |
M5S78_RS05305 (1095947) | 1095947..1096957 | + | 1011 | WP_001363554.1 | DNA-binding transcriptional regulator AscG | - |
M5S78_RS05310 (1097106) | 1097106..1097633 | + | 528 | WP_001078777.1 | electron transport protein HydN | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12426.13 Da Isoelectric Point: 9.7248
>T255898 WP_000547564.1 NZ_CP103626:1091956-1092267 [Escherichia coli]
MHIISKAPFEESARKYPNDALALQALYRVIKETDFSTPEEMRTAFPNLDNFRYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
MHIISKAPFEESARKYPNDALALQALYRVIKETDFSTPEEMRTAFPNLDNFRYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15416.42 Da Isoelectric Point: 4.4596
>AT255898 WP_000126294.1 NZ_CP103626:1092264-1092683 [Escherichia coli]
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLASRIAEYENNNEKFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLASRIAEYENNNEKFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|