Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 4633128..4633730 | Replicon | chromosome |
Accession | NZ_CP103623 | ||
Organism | Escherichia coli strain 3985 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9XIS6 |
Locus tag | M5T36_RS22280 | Protein ID | WP_000897305.1 |
Coordinates | 4633419..4633730 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | M5T36_RS22275 | Protein ID | WP_000356397.1 |
Coordinates | 4633128..4633418 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5T36_RS22250 (4629073) | 4629073..4629975 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
M5T36_RS22255 (4629972) | 4629972..4630607 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
M5T36_RS22260 (4630604) | 4630604..4631533 | + | 930 | WP_000027708.1 | formate dehydrogenase accessory protein FdhE | - |
M5T36_RS22265 (4631863) | 4631863..4632105 | - | 243 | WP_001086388.1 | protein YiiF | - |
M5T36_RS22270 (4632324) | 4632324..4632542 | - | 219 | WP_001611167.1 | CopG family transcriptional regulator | - |
M5T36_RS22275 (4633128) | 4633128..4633418 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
M5T36_RS22280 (4633419) | 4633419..4633730 | - | 312 | WP_000897305.1 | hypothetical protein | Toxin |
M5T36_RS22285 (4633959) | 4633959..4634867 | + | 909 | WP_001162704.1 | alpha/beta hydrolase | - |
M5T36_RS22290 (4634931) | 4634931..4635872 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
M5T36_RS22295 (4635917) | 4635917..4636354 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
M5T36_RS22300 (4636351) | 4636351..4637223 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
M5T36_RS22305 (4637217) | 4637217..4637816 | - | 600 | WP_001295269.1 | glucose-1-phosphatase | - |
M5T36_RS22310 (4637915) | 4637915..4638700 | - | 786 | WP_000059678.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T255890 WP_000897305.1 NZ_CP103623:c4633730-4633419 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|