Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/Tad-HTH_37 |
| Location | 3827437..3828034 | Replicon | chromosome |
| Accession | NZ_CP103621 | ||
| Organism | Klebsiella pneumoniae strain 433 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | R4YIC5 |
| Locus tag | M5S60_RS18735 | Protein ID | WP_004142563.1 |
| Coordinates | 3827717..3828034 (-) | Length | 106 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | R4YH91 |
| Locus tag | M5S60_RS18730 | Protein ID | WP_004142561.1 |
| Coordinates | 3827437..3827724 (-) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5S60_RS18700 (3823517) | 3823517..3823765 | + | 249 | WP_002893037.1 | DUF1158 domain-containing protein | - |
| M5S60_RS18705 (3823783) | 3823783..3824124 | - | 342 | WP_002893035.1 | RamA family antibiotic efflux transcriptional regulator | - |
| M5S60_RS18710 (3824155) | 3824155..3825270 | - | 1116 | WP_012737592.1 | MBL fold metallo-hydrolase | - |
| M5S60_RS18715 (3825450) | 3825450..3826034 | + | 585 | WP_002893026.1 | TetR/AcrR family transcriptional regulator | - |
| M5S60_RS18720 (3826031) | 3826031..3826399 | + | 369 | WP_002893024.1 | MmcQ/YjbR family DNA-binding protein | - |
| M5S60_RS18725 (3826519) | 3826519..3827172 | + | 654 | WP_004178896.1 | oxygen-insensitive NAD(P)H nitroreductase | - |
| M5S60_RS18730 (3827437) | 3827437..3827724 | - | 288 | WP_004142561.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| M5S60_RS18735 (3827717) | 3827717..3828034 | - | 318 | WP_004142563.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| M5S60_RS18740 (3828219) | 3828219..3829262 | - | 1044 | WP_032419264.1 | DUF2157 domain-containing protein | - |
| M5S60_RS18745 (3829929) | 3829929..3830795 | - | 867 | WP_032419265.1 | helix-turn-helix transcriptional regulator | - |
| M5S60_RS18750 (3830904) | 3830904..3832331 | + | 1428 | WP_004176980.1 | MFS transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12110.39 Da Isoelectric Point: 11.2767
>T255865 WP_004142563.1 NZ_CP103621:c3828034-3827717 [Klebsiella pneumoniae]
MFRLVVHVDVKKELQALPPIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
MFRLVVHVDVKKELQALPPIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0M5MXH8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0S3DIQ1 |