Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/Tad-HTH_37 |
| Location | 3968077..3968674 | Replicon | chromosome |
| Accession | NZ_CP103618 | ||
| Organism | Klebsiella pneumoniae strain 4383 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | R4YIC5 |
| Locus tag | M5T08_RS19350 | Protein ID | WP_004142563.1 |
| Coordinates | 3968357..3968674 (-) | Length | 106 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | R4YH91 |
| Locus tag | M5T08_RS19345 | Protein ID | WP_004142561.1 |
| Coordinates | 3968077..3968364 (-) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5T08_RS19315 (3964157) | 3964157..3964405 | + | 249 | WP_020325243.1 | DUF1158 domain-containing protein | - |
| M5T08_RS19320 (3964423) | 3964423..3964764 | - | 342 | Protein_3790 | RamA family antibiotic efflux transcriptional regulator | - |
| M5T08_RS19325 (3964795) | 3964795..3965910 | - | 1116 | WP_020325248.1 | MBL fold metallo-hydrolase | - |
| M5T08_RS19330 (3966090) | 3966090..3966671 | + | 582 | WP_020325240.1 | TetR/AcrR family transcriptional regulator | - |
| M5T08_RS19335 (3966671) | 3966671..3967039 | + | 369 | WP_020325252.1 | MmcQ/YjbR family DNA-binding protein | - |
| M5T08_RS19340 (3967159) | 3967159..3967812 | + | 654 | WP_004178896.1 | oxygen-insensitive NAD(P)H nitroreductase | - |
| M5T08_RS19345 (3968077) | 3968077..3968364 | - | 288 | WP_004142561.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| M5T08_RS19350 (3968357) | 3968357..3968674 | - | 318 | WP_004142563.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| M5T08_RS19355 (3968859) | 3968859..3969902 | - | 1044 | WP_020325241.1 | DUF2157 domain-containing protein | - |
| M5T08_RS19360 (3970572) | 3970572..3971438 | - | 867 | WP_004151823.1 | helix-turn-helix transcriptional regulator | - |
| M5T08_RS19365 (3971547) | 3971547..3972974 | + | 1428 | WP_009308097.1 | MFS transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12110.39 Da Isoelectric Point: 11.2767
>T255848 WP_004142563.1 NZ_CP103618:c3968674-3968357 [Klebsiella pneumoniae]
MFRLVVHVDVKKELQALPPIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
MFRLVVHVDVKKELQALPPIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0M5MXH8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0S3DIQ1 |