Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 358471..359117 | Replicon | chromosome |
| Accession | NZ_CP103614 | ||
| Organism | Klebsiella pneumoniae strain 3571 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A231WWF9 |
| Locus tag | M5T29_RS01665 | Protein ID | WP_004174016.1 |
| Coordinates | 358471..358818 (+) | Length | 116 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A231WWU8 |
| Locus tag | M5T29_RS01670 | Protein ID | WP_004174017.1 |
| Coordinates | 358818..359117 (+) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5T29_RS01655 (M5T29_01655) | 354397..355830 | + | 1434 | WP_002920564.1 | glycogen synthase GlgA | - |
| M5T29_RS01660 (M5T29_01660) | 355848..358295 | + | 2448 | WP_002920561.1 | glycogen phosphorylase | - |
| M5T29_RS01665 (M5T29_01665) | 358471..358818 | + | 348 | WP_004174016.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| M5T29_RS01670 (M5T29_01670) | 358818..359117 | + | 300 | WP_004174017.1 | XRE family transcriptional regulator | Antitoxin |
| M5T29_RS01675 (M5T29_01675) | 359180..360688 | - | 1509 | WP_002920554.1 | glycerol-3-phosphate dehydrogenase | - |
| M5T29_RS01680 (M5T29_01680) | 360893..361222 | + | 330 | WP_002920552.1 | thiosulfate sulfurtransferase GlpE | - |
| M5T29_RS01685 (M5T29_01685) | 361273..362103 | + | 831 | WP_004151408.1 | rhomboid family intramembrane serine protease GlpG | - |
| M5T29_RS01690 (M5T29_01690) | 362153..362911 | + | 759 | WP_002920548.1 | DeoR/GlpR family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 13518.55 Da Isoelectric Point: 6.2327
>T255827 WP_004174016.1 NZ_CP103614:358471-358818 [Klebsiella pneumoniae]
MWDVETTDTFDAWFELQSRALKEDMLATMLILSEFAPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRAFFAFDPLRKAI
VLCAGNKDGMNEKRFYKEMITLADREFSQHLTKER
MWDVETTDTFDAWFELQSRALKEDMLATMLILSEFAPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRAFFAFDPLRKAI
VLCAGNKDGMNEKRFYKEMITLADREFSQHLTKER
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A231WWF9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A231WWU8 |