Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 332283..332869 Replicon chromosome
Accession NZ_CP103614
Organism Klebsiella pneumoniae strain 3571

Toxin (Protein)


Gene name doc Uniprot ID A0A9J6Y968
Locus tag M5T29_RS01555 Protein ID WP_025367836.1
Coordinates 332501..332869 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag M5T29_RS01550 Protein ID WP_004174006.1
Coordinates 332283..332504 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5T29_RS01530 (M5T29_01530) 328440..329366 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
M5T29_RS01535 (M5T29_01535) 329363..330640 + 1278 WP_004188292.1 branched chain amino acid ABC transporter permease LivM -
M5T29_RS01540 (M5T29_01540) 330637..331404 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
M5T29_RS01545 (M5T29_01545) 331406..332119 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
M5T29_RS01550 (M5T29_01550) 332283..332504 + 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
M5T29_RS01555 (M5T29_01555) 332501..332869 + 369 WP_025367836.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
M5T29_RS01560 (M5T29_01560) 333142..334458 + 1317 WP_004174008.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
M5T29_RS01565 (M5T29_01565) 334565..335452 + 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
M5T29_RS01570 (M5T29_01570) 335449..336294 + 846 WP_004145129.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
M5T29_RS01575 (M5T29_01575) 336296..337366 + 1071 WP_004150074.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 329363..338103 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(1-120)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13449.86 Da        Isoelectric Point: 7.2790

>T255826 WP_025367836.1 NZ_CP103614:332501-332869 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIECEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLLG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT255826 WP_004174006.1 NZ_CP103614:332283-332504 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References