Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
| Location | 332283..332869 | Replicon | chromosome |
| Accession | NZ_CP103614 | ||
| Organism | Klebsiella pneumoniae strain 3571 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | A0A9J6Y968 |
| Locus tag | M5T29_RS01555 | Protein ID | WP_025367836.1 |
| Coordinates | 332501..332869 (+) | Length | 123 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | W9B1V1 |
| Locus tag | M5T29_RS01550 | Protein ID | WP_004174006.1 |
| Coordinates | 332283..332504 (+) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5T29_RS01530 (M5T29_01530) | 328440..329366 | + | 927 | WP_002920807.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
| M5T29_RS01535 (M5T29_01535) | 329363..330640 | + | 1278 | WP_004188292.1 | branched chain amino acid ABC transporter permease LivM | - |
| M5T29_RS01540 (M5T29_01540) | 330637..331404 | + | 768 | WP_002920803.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
| M5T29_RS01545 (M5T29_01545) | 331406..332119 | + | 714 | WP_004145133.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF | - |
| M5T29_RS01550 (M5T29_01550) | 332283..332504 | + | 222 | WP_004174006.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| M5T29_RS01555 (M5T29_01555) | 332501..332869 | + | 369 | WP_025367836.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| M5T29_RS01560 (M5T29_01560) | 333142..334458 | + | 1317 | WP_004174008.1 | sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB | - |
| M5T29_RS01565 (M5T29_01565) | 334565..335452 | + | 888 | WP_002920792.1 | sn-glycerol-3-phosphate ABC transporter permease UgpA | - |
| M5T29_RS01570 (M5T29_01570) | 335449..336294 | + | 846 | WP_004145129.1 | sn-glycerol-3-phosphate ABC transporter permease UgpE | - |
| M5T29_RS01575 (M5T29_01575) | 336296..337366 | + | 1071 | WP_004150074.1 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Prophage | - | - | 329363..338103 | 8740 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13449.86 Da Isoelectric Point: 7.2790
>T255826 WP_025367836.1 NZ_CP103614:332501-332869 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIECEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLLG
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIECEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLLG
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|