Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 4862720..4863322 | Replicon | chromosome |
| Accession | NZ_CP103611 | ||
| Organism | Enterobacter cloacae strain 3143 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A5E1AN02 |
| Locus tag | M5S62_RS23190 | Protein ID | WP_013099360.1 |
| Coordinates | 4863011..4863322 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | M5S62_RS23185 | Protein ID | WP_013099359.1 |
| Coordinates | 4862720..4863010 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5S62_RS23170 (M5S62_23170) | 4860217..4861119 | + | 903 | WP_014833793.1 | formate dehydrogenase subunit beta | - |
| M5S62_RS23175 (M5S62_23175) | 4861116..4861751 | + | 636 | WP_023622447.1 | formate dehydrogenase cytochrome b556 subunit | - |
| M5S62_RS23180 (M5S62_23180) | 4861748..4862677 | + | 930 | WP_095428069.1 | formate dehydrogenase accessory protein FdhE | - |
| M5S62_RS23185 (M5S62_23185) | 4862720..4863010 | - | 291 | WP_013099359.1 | helix-turn-helix domain-containing protein | Antitoxin |
| M5S62_RS23190 (M5S62_23190) | 4863011..4863322 | - | 312 | WP_013099360.1 | hypothetical protein | Toxin |
| M5S62_RS23195 (M5S62_23195) | 4863552..4864469 | + | 918 | WP_259387503.1 | alpha/beta hydrolase | - |
| M5S62_RS23200 (M5S62_23200) | 4864482..4865423 | - | 942 | WP_013099362.1 | fatty acid biosynthesis protein FabY | - |
| M5S62_RS23205 (M5S62_23205) | 4865468..4865905 | - | 438 | WP_013099363.1 | D-aminoacyl-tRNA deacylase | - |
| M5S62_RS23210 (M5S62_23210) | 4865902..4866783 | - | 882 | WP_013099364.1 | virulence factor BrkB family protein | - |
| M5S62_RS23215 (M5S62_23215) | 4866777..4867376 | - | 600 | WP_013099365.1 | glucose-1-phosphatase | - |
| M5S62_RS23220 (M5S62_23220) | 4867496..4868296 | - | 801 | WP_020686879.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12210.18 Da Isoelectric Point: 9.7550
>T255822 WP_013099360.1 NZ_CP103611:c4863322-4863011 [Enterobacter cloacae]
MLFIETDIFTEDVKTLLDDDEYHKLQVFLATQPDYGDLIQNTGGLRKIRWLSGGRGKRGGVRVIYFHRTHEFEIRLLLIY
RKGIKDDLSAREKAILKKMIERW
MLFIETDIFTEDVKTLLDDDEYHKLQVFLATQPDYGDLIQNTGGLRKIRWLSGGRGKRGGVRVIYFHRTHEFEIRLLLIY
RKGIKDDLSAREKAILKKMIERW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|