Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 4312944..4313743 | Replicon | chromosome |
| Accession | NZ_CP103609 | ||
| Organism | Escherichia coli strain 4314 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | U9XVR9 |
| Locus tag | M5S83_RS20770 | Protein ID | WP_000347267.1 |
| Coordinates | 4313279..4313743 (+) | Length | 155 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | S1EB98 |
| Locus tag | M5S83_RS20765 | Protein ID | WP_001307405.1 |
| Coordinates | 4312944..4313279 (+) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5S83_RS20750 (4308730) | 4308730..4309500 | - | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
| M5S83_RS20755 (4309516) | 4309516..4310850 | - | 1335 | WP_000599636.1 | galactarate/glucarate/glycerate transporter GarP | - |
| M5S83_RS20760 (4311225) | 4311225..4312796 | + | 1572 | WP_001273741.1 | galactarate dehydratase | - |
| M5S83_RS20765 (4312944) | 4312944..4313279 | + | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
| M5S83_RS20770 (4313279) | 4313279..4313743 | + | 465 | WP_000347267.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
| M5S83_RS20775 (4313798) | 4313798..4314607 | - | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
| M5S83_RS20780 (4314856) | 4314856..4316136 | + | 1281 | WP_000681921.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
| M5S83_RS20785 (4316159) | 4316159..4316632 | + | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
| M5S83_RS20790 (4316643) | 4316643..4317422 | + | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
| M5S83_RS20795 (4317412) | 4317412..4318290 | + | 879 | WP_001298758.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
| M5S83_RS20800 (4318308) | 4318308..4318742 | + | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4302289..4313743 | 11454 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17807.17 Da Isoelectric Point: 9.4947
>T255808 WP_000347267.1 NZ_CP103609:4313279-4313743 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0XTR4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0XVC7 |