Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
Location | 2204728..2204948 | Replicon | chromosome |
Accession | NZ_CP103609 | ||
Organism | Escherichia coli strain 4314 |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | S1PGT3 |
Locus tag | M5S83_RS10695 | Protein ID | WP_000170954.1 |
Coordinates | 2204728..2204835 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | rdlD | ||
Locus tag | - | ||
Coordinates | 2204885..2204948 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5S83_RS10670 (2200572) | 2200572..2201654 | + | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
M5S83_RS10675 (2201654) | 2201654..2202487 | + | 834 | WP_000456571.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
M5S83_RS10680 (2202484) | 2202484..2202876 | + | 393 | WP_000200378.1 | invasion regulator SirB2 | - |
M5S83_RS10685 (2202880) | 2202880..2203689 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
M5S83_RS10690 (2203725) | 2203725..2204579 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
M5S83_RS10695 (2204728) | 2204728..2204835 | - | 108 | WP_000170954.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
- (2204885) | 2204885..2204948 | + | 64 | NuclAT_45 | - | Antitoxin |
- (2204885) | 2204885..2204948 | + | 64 | NuclAT_45 | - | Antitoxin |
- (2204885) | 2204885..2204948 | + | 64 | NuclAT_45 | - | Antitoxin |
- (2204885) | 2204885..2204948 | + | 64 | NuclAT_45 | - | Antitoxin |
- (2204885) | 2204885..2204948 | + | 64 | NuclAT_48 | - | Antitoxin |
- (2204885) | 2204885..2204948 | + | 64 | NuclAT_48 | - | Antitoxin |
- (2204885) | 2204885..2204948 | + | 64 | NuclAT_48 | - | Antitoxin |
- (2204885) | 2204885..2204948 | + | 64 | NuclAT_48 | - | Antitoxin |
- (2204885) | 2204885..2204948 | + | 64 | NuclAT_51 | - | Antitoxin |
- (2204885) | 2204885..2204948 | + | 64 | NuclAT_51 | - | Antitoxin |
- (2204885) | 2204885..2204948 | + | 64 | NuclAT_51 | - | Antitoxin |
- (2204885) | 2204885..2204948 | + | 64 | NuclAT_51 | - | Antitoxin |
M5S83_RS10700 (2205263) | 2205263..2205370 | - | 108 | WP_000170926.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
- (2205423) | 2205423..2205484 | + | 62 | NuclAT_44 | - | - |
- (2205423) | 2205423..2205484 | + | 62 | NuclAT_44 | - | - |
- (2205423) | 2205423..2205484 | + | 62 | NuclAT_44 | - | - |
- (2205423) | 2205423..2205484 | + | 62 | NuclAT_44 | - | - |
- (2205423) | 2205423..2205484 | + | 62 | NuclAT_47 | - | - |
- (2205423) | 2205423..2205484 | + | 62 | NuclAT_47 | - | - |
- (2205423) | 2205423..2205484 | + | 62 | NuclAT_47 | - | - |
- (2205423) | 2205423..2205484 | + | 62 | NuclAT_47 | - | - |
- (2205423) | 2205423..2205484 | + | 62 | NuclAT_50 | - | - |
- (2205423) | 2205423..2205484 | + | 62 | NuclAT_50 | - | - |
- (2205423) | 2205423..2205484 | + | 62 | NuclAT_50 | - | - |
- (2205423) | 2205423..2205484 | + | 62 | NuclAT_50 | - | - |
- (2205423) | 2205423..2205486 | + | 64 | NuclAT_14 | - | - |
- (2205423) | 2205423..2205486 | + | 64 | NuclAT_14 | - | - |
- (2205423) | 2205423..2205486 | + | 64 | NuclAT_14 | - | - |
- (2205423) | 2205423..2205486 | + | 64 | NuclAT_14 | - | - |
- (2205423) | 2205423..2205486 | + | 64 | NuclAT_16 | - | - |
- (2205423) | 2205423..2205486 | + | 64 | NuclAT_16 | - | - |
- (2205423) | 2205423..2205486 | + | 64 | NuclAT_16 | - | - |
- (2205423) | 2205423..2205486 | + | 64 | NuclAT_16 | - | - |
- (2205423) | 2205423..2205486 | + | 64 | NuclAT_18 | - | - |
- (2205423) | 2205423..2205486 | + | 64 | NuclAT_18 | - | - |
- (2205423) | 2205423..2205486 | + | 64 | NuclAT_18 | - | - |
- (2205423) | 2205423..2205486 | + | 64 | NuclAT_18 | - | - |
- (2205423) | 2205423..2205486 | + | 64 | NuclAT_20 | - | - |
- (2205423) | 2205423..2205486 | + | 64 | NuclAT_20 | - | - |
- (2205423) | 2205423..2205486 | + | 64 | NuclAT_20 | - | - |
- (2205423) | 2205423..2205486 | + | 64 | NuclAT_20 | - | - |
- (2205423) | 2205423..2205486 | + | 64 | NuclAT_22 | - | - |
- (2205423) | 2205423..2205486 | + | 64 | NuclAT_22 | - | - |
- (2205423) | 2205423..2205486 | + | 64 | NuclAT_22 | - | - |
- (2205423) | 2205423..2205486 | + | 64 | NuclAT_22 | - | - |
- (2205423) | 2205423..2205486 | + | 64 | NuclAT_24 | - | - |
- (2205423) | 2205423..2205486 | + | 64 | NuclAT_24 | - | - |
- (2205423) | 2205423..2205486 | + | 64 | NuclAT_24 | - | - |
- (2205423) | 2205423..2205486 | + | 64 | NuclAT_24 | - | - |
M5S83_RS10705 (2205799) | 2205799..2205906 | - | 108 | WP_000170965.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
- (2205954) | 2205954..2206019 | + | 66 | NuclAT_43 | - | - |
- (2205954) | 2205954..2206019 | + | 66 | NuclAT_43 | - | - |
- (2205954) | 2205954..2206019 | + | 66 | NuclAT_43 | - | - |
- (2205954) | 2205954..2206019 | + | 66 | NuclAT_43 | - | - |
- (2205954) | 2205954..2206019 | + | 66 | NuclAT_46 | - | - |
- (2205954) | 2205954..2206019 | + | 66 | NuclAT_46 | - | - |
- (2205954) | 2205954..2206019 | + | 66 | NuclAT_46 | - | - |
- (2205954) | 2205954..2206019 | + | 66 | NuclAT_46 | - | - |
- (2205954) | 2205954..2206019 | + | 66 | NuclAT_49 | - | - |
- (2205954) | 2205954..2206019 | + | 66 | NuclAT_49 | - | - |
- (2205954) | 2205954..2206019 | + | 66 | NuclAT_49 | - | - |
- (2205954) | 2205954..2206019 | + | 66 | NuclAT_49 | - | - |
- (2205954) | 2205954..2206021 | + | 68 | NuclAT_13 | - | - |
- (2205954) | 2205954..2206021 | + | 68 | NuclAT_13 | - | - |
- (2205954) | 2205954..2206021 | + | 68 | NuclAT_13 | - | - |
- (2205954) | 2205954..2206021 | + | 68 | NuclAT_13 | - | - |
- (2205954) | 2205954..2206021 | + | 68 | NuclAT_15 | - | - |
- (2205954) | 2205954..2206021 | + | 68 | NuclAT_15 | - | - |
- (2205954) | 2205954..2206021 | + | 68 | NuclAT_15 | - | - |
- (2205954) | 2205954..2206021 | + | 68 | NuclAT_15 | - | - |
- (2205954) | 2205954..2206021 | + | 68 | NuclAT_17 | - | - |
- (2205954) | 2205954..2206021 | + | 68 | NuclAT_17 | - | - |
- (2205954) | 2205954..2206021 | + | 68 | NuclAT_17 | - | - |
- (2205954) | 2205954..2206021 | + | 68 | NuclAT_17 | - | - |
- (2205954) | 2205954..2206021 | + | 68 | NuclAT_19 | - | - |
- (2205954) | 2205954..2206021 | + | 68 | NuclAT_19 | - | - |
- (2205954) | 2205954..2206021 | + | 68 | NuclAT_19 | - | - |
- (2205954) | 2205954..2206021 | + | 68 | NuclAT_19 | - | - |
- (2205954) | 2205954..2206021 | + | 68 | NuclAT_21 | - | - |
- (2205954) | 2205954..2206021 | + | 68 | NuclAT_21 | - | - |
- (2205954) | 2205954..2206021 | + | 68 | NuclAT_21 | - | - |
- (2205954) | 2205954..2206021 | + | 68 | NuclAT_21 | - | - |
- (2205954) | 2205954..2206021 | + | 68 | NuclAT_23 | - | - |
- (2205954) | 2205954..2206021 | + | 68 | NuclAT_23 | - | - |
- (2205954) | 2205954..2206021 | + | 68 | NuclAT_23 | - | - |
- (2205954) | 2205954..2206021 | + | 68 | NuclAT_23 | - | - |
M5S83_RS10710 (2206311) | 2206311..2207411 | - | 1101 | WP_001295620.1 | sodium-potassium/proton antiporter ChaA | - |
M5S83_RS10715 (2207681) | 2207681..2207911 | + | 231 | WP_001146442.1 | putative cation transport regulator ChaB | - |
M5S83_RS10720 (2208069) | 2208069..2208764 | + | 696 | WP_001297117.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
M5S83_RS10725 (2208808) | 2208808..2209161 | - | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3983.80 Da Isoelectric Point: 11.4779
>T255798 WP_000170954.1 NZ_CP103609:c2204835-2204728 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK
Download Length: 108 bp
Antitoxin
Download Length: 64 bp
>AT255798 NZ_CP103609:2204885-2204948 [Escherichia coli]
TCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCT
TCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|