Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 2204728..2204948 Replicon chromosome
Accession NZ_CP103609
Organism Escherichia coli strain 4314

Toxin (Protein)


Gene name ldrD Uniprot ID S1PGT3
Locus tag M5S83_RS10695 Protein ID WP_000170954.1
Coordinates 2204728..2204835 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 2204885..2204948 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5S83_RS10670 (2200572) 2200572..2201654 + 1083 WP_000804726.1 peptide chain release factor 1 -
M5S83_RS10675 (2201654) 2201654..2202487 + 834 WP_000456571.1 peptide chain release factor N(5)-glutamine methyltransferase -
M5S83_RS10680 (2202484) 2202484..2202876 + 393 WP_000200378.1 invasion regulator SirB2 -
M5S83_RS10685 (2202880) 2202880..2203689 + 810 WP_001257044.1 invasion regulator SirB1 -
M5S83_RS10690 (2203725) 2203725..2204579 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
M5S83_RS10695 (2204728) 2204728..2204835 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (2204885) 2204885..2204948 + 64 NuclAT_45 - Antitoxin
- (2204885) 2204885..2204948 + 64 NuclAT_45 - Antitoxin
- (2204885) 2204885..2204948 + 64 NuclAT_45 - Antitoxin
- (2204885) 2204885..2204948 + 64 NuclAT_45 - Antitoxin
- (2204885) 2204885..2204948 + 64 NuclAT_48 - Antitoxin
- (2204885) 2204885..2204948 + 64 NuclAT_48 - Antitoxin
- (2204885) 2204885..2204948 + 64 NuclAT_48 - Antitoxin
- (2204885) 2204885..2204948 + 64 NuclAT_48 - Antitoxin
- (2204885) 2204885..2204948 + 64 NuclAT_51 - Antitoxin
- (2204885) 2204885..2204948 + 64 NuclAT_51 - Antitoxin
- (2204885) 2204885..2204948 + 64 NuclAT_51 - Antitoxin
- (2204885) 2204885..2204948 + 64 NuclAT_51 - Antitoxin
M5S83_RS10700 (2205263) 2205263..2205370 - 108 WP_000170926.1 type I toxin-antitoxin system toxin Ldr family protein -
- (2205423) 2205423..2205484 + 62 NuclAT_44 - -
- (2205423) 2205423..2205484 + 62 NuclAT_44 - -
- (2205423) 2205423..2205484 + 62 NuclAT_44 - -
- (2205423) 2205423..2205484 + 62 NuclAT_44 - -
- (2205423) 2205423..2205484 + 62 NuclAT_47 - -
- (2205423) 2205423..2205484 + 62 NuclAT_47 - -
- (2205423) 2205423..2205484 + 62 NuclAT_47 - -
- (2205423) 2205423..2205484 + 62 NuclAT_47 - -
- (2205423) 2205423..2205484 + 62 NuclAT_50 - -
- (2205423) 2205423..2205484 + 62 NuclAT_50 - -
- (2205423) 2205423..2205484 + 62 NuclAT_50 - -
- (2205423) 2205423..2205484 + 62 NuclAT_50 - -
- (2205423) 2205423..2205486 + 64 NuclAT_14 - -
- (2205423) 2205423..2205486 + 64 NuclAT_14 - -
- (2205423) 2205423..2205486 + 64 NuclAT_14 - -
- (2205423) 2205423..2205486 + 64 NuclAT_14 - -
- (2205423) 2205423..2205486 + 64 NuclAT_16 - -
- (2205423) 2205423..2205486 + 64 NuclAT_16 - -
- (2205423) 2205423..2205486 + 64 NuclAT_16 - -
- (2205423) 2205423..2205486 + 64 NuclAT_16 - -
- (2205423) 2205423..2205486 + 64 NuclAT_18 - -
- (2205423) 2205423..2205486 + 64 NuclAT_18 - -
- (2205423) 2205423..2205486 + 64 NuclAT_18 - -
- (2205423) 2205423..2205486 + 64 NuclAT_18 - -
- (2205423) 2205423..2205486 + 64 NuclAT_20 - -
- (2205423) 2205423..2205486 + 64 NuclAT_20 - -
- (2205423) 2205423..2205486 + 64 NuclAT_20 - -
- (2205423) 2205423..2205486 + 64 NuclAT_20 - -
- (2205423) 2205423..2205486 + 64 NuclAT_22 - -
- (2205423) 2205423..2205486 + 64 NuclAT_22 - -
- (2205423) 2205423..2205486 + 64 NuclAT_22 - -
- (2205423) 2205423..2205486 + 64 NuclAT_22 - -
- (2205423) 2205423..2205486 + 64 NuclAT_24 - -
- (2205423) 2205423..2205486 + 64 NuclAT_24 - -
- (2205423) 2205423..2205486 + 64 NuclAT_24 - -
- (2205423) 2205423..2205486 + 64 NuclAT_24 - -
M5S83_RS10705 (2205799) 2205799..2205906 - 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein -
- (2205954) 2205954..2206019 + 66 NuclAT_43 - -
- (2205954) 2205954..2206019 + 66 NuclAT_43 - -
- (2205954) 2205954..2206019 + 66 NuclAT_43 - -
- (2205954) 2205954..2206019 + 66 NuclAT_43 - -
- (2205954) 2205954..2206019 + 66 NuclAT_46 - -
- (2205954) 2205954..2206019 + 66 NuclAT_46 - -
- (2205954) 2205954..2206019 + 66 NuclAT_46 - -
- (2205954) 2205954..2206019 + 66 NuclAT_46 - -
- (2205954) 2205954..2206019 + 66 NuclAT_49 - -
- (2205954) 2205954..2206019 + 66 NuclAT_49 - -
- (2205954) 2205954..2206019 + 66 NuclAT_49 - -
- (2205954) 2205954..2206019 + 66 NuclAT_49 - -
- (2205954) 2205954..2206021 + 68 NuclAT_13 - -
- (2205954) 2205954..2206021 + 68 NuclAT_13 - -
- (2205954) 2205954..2206021 + 68 NuclAT_13 - -
- (2205954) 2205954..2206021 + 68 NuclAT_13 - -
- (2205954) 2205954..2206021 + 68 NuclAT_15 - -
- (2205954) 2205954..2206021 + 68 NuclAT_15 - -
- (2205954) 2205954..2206021 + 68 NuclAT_15 - -
- (2205954) 2205954..2206021 + 68 NuclAT_15 - -
- (2205954) 2205954..2206021 + 68 NuclAT_17 - -
- (2205954) 2205954..2206021 + 68 NuclAT_17 - -
- (2205954) 2205954..2206021 + 68 NuclAT_17 - -
- (2205954) 2205954..2206021 + 68 NuclAT_17 - -
- (2205954) 2205954..2206021 + 68 NuclAT_19 - -
- (2205954) 2205954..2206021 + 68 NuclAT_19 - -
- (2205954) 2205954..2206021 + 68 NuclAT_19 - -
- (2205954) 2205954..2206021 + 68 NuclAT_19 - -
- (2205954) 2205954..2206021 + 68 NuclAT_21 - -
- (2205954) 2205954..2206021 + 68 NuclAT_21 - -
- (2205954) 2205954..2206021 + 68 NuclAT_21 - -
- (2205954) 2205954..2206021 + 68 NuclAT_21 - -
- (2205954) 2205954..2206021 + 68 NuclAT_23 - -
- (2205954) 2205954..2206021 + 68 NuclAT_23 - -
- (2205954) 2205954..2206021 + 68 NuclAT_23 - -
- (2205954) 2205954..2206021 + 68 NuclAT_23 - -
M5S83_RS10710 (2206311) 2206311..2207411 - 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
M5S83_RS10715 (2207681) 2207681..2207911 + 231 WP_001146442.1 putative cation transport regulator ChaB -
M5S83_RS10720 (2208069) 2208069..2208764 + 696 WP_001297117.1 glutathione-specific gamma-glutamylcyclotransferase -
M5S83_RS10725 (2208808) 2208808..2209161 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3983.80 Da        Isoelectric Point: 11.4779

>T255798 WP_000170954.1 NZ_CP103609:c2204835-2204728 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

Antitoxin


Download         Length: 64 bp

>AT255798 NZ_CP103609:2204885-2204948 [Escherichia coli]
TCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9LPE9

Antitoxin

Download structure file

References